BLASTX nr result
ID: Ophiopogon23_contig00006934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006934 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255162.1| photosynthetic NDH subunit of lumenal locati... 57 9e-07 >ref|XP_020255162.1| photosynthetic NDH subunit of lumenal location 3, chloroplastic [Asparagus officinalis] Length = 217 Score = 56.6 bits (135), Expect = 9e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 448 EKLEDAVKKKSDPSTRSIYDETTVVLKEVMARMA 347 EKLEDAVK+KSDP TRS Y +TTVVL+EVMARMA Sbjct: 184 EKLEDAVKQKSDPLTRSCYHDTTVVLQEVMARMA 217