BLASTX nr result
ID: Ophiopogon23_contig00006750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006750 (1599 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJH53109.1| core histone H2A/H2B/H3/H4 [Dictyocaulus viviparus] 266 4e-84 gb|KOC69409.1| Histone H3.3, partial [Habropoda laboriosa] 265 1e-83 gb|PIK49100.1| core histone H2A/H2B/H3/H4 [Apostichopus japonicus] 265 1e-83 ref|NP_002098.1| histone H3.3 [Homo sapiens] >gi|4885385|ref|NP_... 265 1e-83 pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing Th... 265 2e-83 ref|XP_015819260.1| PREDICTED: histone H3.3 isoform X1 [Nothobra... 265 2e-83 pdb|3WTP|E Chain E, Crystal Structure of the heterotypic nucleos... 265 2e-83 gb|ACO07612.1| Histone H3.3 [Oncorhynchus mykiss] 264 2e-83 ref|XP_009166091.1| hypothetical protein T265_13221, partial [Op... 264 2e-83 gb|PIS88409.1| core histone H2A/H2B/H3/H4 [Fasciola hepatica] 264 3e-83 ref|XP_019924179.1| PREDICTED: histone H3.3 [Crassostrea gigas] 268 4e-83 gb|PRD19945.1| Histone H3.3 [Nephila clavipes] 263 4e-83 ref|NP_509344.1| Histone H3.3 type 1 [Caenorhabditis elegans] >g... 263 4e-83 ref|XP_020031675.1| histone H3.3-like [Castor canadensis] 263 4e-83 ref|XP_015139223.1| PREDICTED: histone H3.2 isoform X1 [Gallus g... 263 4e-83 gb|EDL18362.1| mCG6162 [Mus musculus] 263 4e-83 ref|XP_001623766.1| predicted protein [Nematostella vectensis] >... 263 4e-83 ref|XP_010832083.1| PREDICTED: histone H3.3-like [Bison bison bi... 263 4e-83 gb|AIS25392.1| histone H3.3 [Mytilus galloprovincialis] 263 4e-83 gb|AIS25385.1| histone H3.3 [Mytilus edulis] 263 4e-83 >gb|KJH53109.1| core histone H2A/H2B/H3/H4 [Dictyocaulus viviparus] Length = 150 Score = 266 bits (681), Expect = 4e-84 Identities = 138/153 (90%), Positives = 146/153 (95%) Frame = -2 Query: 1511 VYLLKFLIKVNQFDN*KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR 1332 +++++ L K+ + + MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR Sbjct: 1 MFIIRKLAKILELE---MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR 57 Query: 1331 PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVG 1152 PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVG Sbjct: 58 PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVG 117 Query: 1151 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 1053 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 118 LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 150 >gb|KOC69409.1| Histone H3.3, partial [Habropoda laboriosa] Length = 138 Score = 265 bits (677), Expect = 1e-83 Identities = 136/137 (99%), Positives = 137/137 (100%) Frame = -2 Query: 1463 KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST 1284 +MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST Sbjct: 2 EMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST 61 Query: 1283 ELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT 1104 ELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT Sbjct: 62 ELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT 121 Query: 1103 IMPKDIQLARRIRGERA 1053 IMPKDIQLARRIRGERA Sbjct: 122 IMPKDIQLARRIRGERA 138 >gb|PIK49100.1| core histone H2A/H2B/H3/H4 [Apostichopus japonicus] Length = 144 Score = 265 bits (677), Expect = 1e-83 Identities = 136/137 (99%), Positives = 137/137 (100%) Frame = -2 Query: 1463 KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST 1284 KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST Sbjct: 8 KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKST 67 Query: 1283 ELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT 1104 ELLIRKLPFQRLVREIAQDFKT+LRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT Sbjct: 68 ELLIRKLPFQRLVREIAQDFKTELRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT 127 Query: 1103 IMPKDIQLARRIRGERA 1053 IMPKDIQLARRIRGERA Sbjct: 128 IMPKDIQLARRIRGERA 144 >ref|NP_002098.1| histone H3.3 [Homo sapiens] ref|NP_005315.1| histone H3.3 [Homo sapiens] ref|NP_032236.1| histone H3.3 [Mus musculus] ref|NP_032237.1| histone H3.3 [Mus musculus] ref|NP_446437.1| histone H3.3 [Rattus norvegicus] ref|NP_511095.1| histone H3.3B, isoform A [Drosophila melanogaster] ref|NP_523479.1| histone H3.3A, isoform A [Drosophila melanogaster] ref|NP_727314.1| histone H3.3B, isoform B [Drosophila melanogaster] ref|NP_788892.1| histone H3.3B, isoform C [Drosophila melanogaster] ref|NP_956297.1| H3 histone, family 3C [Danio rerio] ref|NP_957395.1| H3 histone, family 3D [Danio rerio] ref|NP_989026.1| histone H3.3 [Xenopus tropicalis] ref|NP_990627.1| histone H3.3 [Gallus gallus] ref|NP_999095.1| histone H3.3 [Sus scrofa] ref|NP_001005101.1| histone H3.3 [Xenopus tropicalis] ref|NP_001014411.1| histone H3.3 [Bos taurus] ref|NP_001017599.1| histone H3.3 [Danio rerio] ref|NP_001080065.1| H3 histone, family 3B (H3.3B) [Xenopus laevis] ref|NP_001086074.1| histone cluster 2, H3d L homeolog [Xenopus laevis] ref|NP_001085048.1| H3 histone, family 3B (H3.3B) L homeolog [Xenopus laevis] ref|NP_001079375.1| histone H3.3 [Xenopus laevis] ref|NP_001091756.1| h3 histone family 3a [Bombyx mori] ref|NP_001091902.1| H3 histone, family 3A L homeolog [Xenopus laevis] ref|NP_001092038.1| histone cluster 1, H3a [Pan troglodytes] ref|NP_001162389.1| histone H3.1 [Papio anubis] ref|NP_001164583.1| histone H3.3 [Oryctolagus cuniculus] ref|NP_001184227.1| histone H3.3 [Taeniopygia guttata] ref|NP_001184233.1| histone H3.3 [Taeniopygia guttata] ref|NP_001191424.1| histone 3 [Aplysia californica] ref|NP_001229500.1| histone H3.3 [Bos taurus] ref|NP_001259374.1| histone H3.3B, isoform E [Drosophila melanogaster] ref|NP_001260082.1| histone H3.3A, isoform C [Drosophila melanogaster] ref|NP_723056.2| histone H3.3A, isoform D [Drosophila melanogaster] ref|NP_001267377.1| histone H3.3 [Pan troglodytes] ref|NP_001026653.2| histone H3.2 [Gallus gallus] ref|NP_001279370.1| histone H3.3 [Callorhinchus milii] ref|NP_001298478.1| histone H3.3 [Papilio polytes] ref|NP_001299690.1| histone H3.3 [Papilio xuthus] ref|XP_321242.1| AGAP001813-PA [Anopheles gambiae str. PEST] ref|XP_537232.1| histone H3.3 [Canis lupus familiaris] ref|XP_624499.1| PREDICTED: histone H3.3 [Apis mellifera] ref|XP_858804.1| histone H3.3 [Canis lupus familiaris] ref|XP_001355964.1| uncharacterized protein Dpse_GA19158 [Drosophila pseudoobscura pseudoobscura] ref|XP_001368225.1| PREDICTED: histone H3.3 [Monodelphis domestica] ref|XP_001608166.1| PREDICTED: histone H3.3 [Nasonia vitripennis] ref|XP_001608174.1| PREDICTED: histone H3.3 [Nasonia vitripennis] ref|XP_001657554.1| histone H3.3 [Aedes aegypti] ref|XP_001867328.1| histone H3.3 type 2 [Culex quinquefasciatus] ref|XP_001897416.1| Histone H3.3 [Brugia malayi] ref|XP_001899461.1| Histone H3.3 [Brugia malayi] ref|XP_001962995.1| uncharacterized protein Dana_GF15720 [Drosophila ananassae] ref|XP_001966717.1| uncharacterized protein Dana_GF19171 [Drosophila ananassae] ref|XP_001968765.1| uncharacterized protein Dere_GG25048 [Drosophila erecta] ref|XP_001977366.1| uncharacterized protein Dere_GG19000 [Drosophila erecta] ref|XP_001989021.1| GH11489 [Drosophila grimshawi] ref|XP_001992391.1| GH24723 [Drosophila grimshawi] ref|XP_002001685.1| uncharacterized protein Dmoj_GI16984 [Drosophila mojavensis] ref|XP_002010097.1| uncharacterized protein Dmoj_GI14879 [Drosophila mojavensis] ref|XP_002021511.1| GL26550 [Drosophila persimilis] ref|XP_002025032.1| GL26831 [Drosophila persimilis] ref|XP_002037914.1| GM18523 [Drosophila sechellia] ref|XP_002043987.1| GM13676 [Drosophila sechellia] ref|XP_002051859.1| uncharacterized protein Dvir_GJ17231 [Drosophila virilis] ref|XP_002058949.1| uncharacterized protein Dvir_GJ15308 [Drosophila virilis] ref|XP_002064500.1| histone H3.3 [Drosophila willistoni] ref|XP_002088675.1| His3.3A [Drosophila yakuba] ref|XP_002101068.1| uncharacterized protein Dyak_GE17412 [Drosophila yakuba] ref|XP_002078203.1| uncharacterized protein Dsimw501_GD23319 [Drosophila simulans] ref|XP_002134231.1| uncharacterized protein Dpse_GA22698 [Drosophila pseudoobscura pseudoobscura] ref|XP_002399568.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] ref|XP_002430660.1| histone H3.3 [Pediculus humanus corporis] ref|XP_002589240.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] ref|XP_002595623.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] ref|XP_002732447.1| PREDICTED: histone H3.3-like [Saccoglossus kowalevskii] ref|XP_002732967.1| PREDICTED: histone H3.3-like [Saccoglossus kowalevskii] ref|XP_002664801.1| histone H3.3 [Danio rerio] ref|XP_002728089.1| PREDICTED: histone H3.3 [Rattus norvegicus] ref|XP_002745967.1| PREDICTED: histone H3.3 [Callithrix jacchus] ref|XP_002748789.1| PREDICTED: histone H3.3 [Callithrix jacchus] ref|XP_002760051.1| PREDICTED: histone H3.3 [Callithrix jacchus] ref|XP_002760634.1| PREDICTED: histone H3.3 [Callithrix jacchus] ref|XP_002802116.1| PREDICTED: histone H3.3 [Macaca mulatta] ref|XP_002809433.1| histone H3.3 [Pongo abelii] ref|XP_002919897.1| PREDICTED: histone H3.3 [Ailuropoda melanoleuca] ref|XP_002926741.1| PREDICTED: histone H3.3 [Ailuropoda melanoleuca] ref|XP_003131242.1| histone H3.3 [Sus scrofa] ref|XP_003140744.1| H3 histone, family 3A [Loa loa] ref|XP_003149523.1| histone H3 [Loa loa] ref|XP_003211494.1| PREDICTED: histone H3.3 [Meleagris gallopavo] ref|XP_003216117.1| PREDICTED: histone H3.3 [Anolis carolinensis] ref|XP_003217253.1| PREDICTED: histone H3.3 [Anolis carolinensis] ref|XP_003222905.1| PREDICTED: histone H3.3 [Anolis carolinensis] ref|XP_003249043.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum] ref|XP_003263420.1| PREDICTED: histone H3.3 [Nomascus leucogenys] ref|XP_003275139.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_003275143.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_003275144.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_003275145.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_003279138.1| PREDICTED: histone H3.3 isoform X2 [Nomascus leucogenys] ref|XP_003386893.1| PREDICTED: histone H3.3 [Amphimedon queenslandica] ref|XP_003400767.1| histone H3.3 [Bombus terrestris] ref|XP_003400771.1| histone H3.3 [Bombus terrestris] ref|XP_003400772.1| histone H3.3 [Bombus terrestris] ref|XP_003410978.1| histone H3.3 [Loxodonta africana] ref|XP_003435952.1| AGAP001813-PB [Anopheles gambiae str. PEST] ref|XP_003438823.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_003449844.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_003461470.1| histone H3.3 [Cavia porcellus] ref|XP_003462414.1| histone H3.3 [Cavia porcellus] ref|XP_003485156.1| histone H3.3 [Bombus impatiens] ref|XP_003694444.1| PREDICTED: histone H3.3 [Apis florea] ref|XP_003708096.1| PREDICTED: histone H3.3 [Megachile rotundata] ref|XP_003708097.1| PREDICTED: histone H3.3 [Megachile rotundata] ref|XP_003739008.1| PREDICTED: histone H3.3 [Galendromus occidentalis] ref|XP_003748371.1| PREDICTED: histone H3.3 [Galendromus occidentalis] ref|XP_003752732.1| PREDICTED: histone H3.3 [Rattus norvegicus] ref|XP_003767801.1| histone H3.3 [Sarcophilus harrisii] ref|XP_003786173.1| histone H3.3 [Otolemur garnettii] ref|XP_003791041.1| histone H3.3 [Otolemur garnettii] ref|XP_003813324.1| PREDICTED: histone H3.3 [Pan paniscus] ref|XP_003814967.1| PREDICTED: histone H3.3 [Pan paniscus] ref|XP_003893086.1| histone H3.3 [Papio anubis] ref|XP_003893531.1| histone H3.3 [Papio anubis] ref|XP_003913493.1| histone H3.3 [Papio anubis] ref|XP_003930341.1| PREDICTED: histone H3.3 [Saimiri boliviensis boliviensis] ref|XP_003931776.1| PREDICTED: histone H3.3 [Saimiri boliviensis boliviensis] ref|XP_003961353.1| PREDICTED: histone H3.3 [Takifugu rubripes] ref|XP_003970774.1| PREDICTED: histone H3.3 [Takifugu rubripes] ref|XP_004013172.1| PREDICTED: histone H3.3 isoform X1 [Ovis aries] ref|XP_004013682.1| PREDICTED: histone H3.3 [Ovis aries] ref|XP_004028534.1| PREDICTED: histone H3.3 [Gorilla gorilla gorilla] ref|XP_004041067.1| PREDICTED: histone H3.3 [Gorilla gorilla gorilla] ref|XP_004080398.1| histone H3.3 [Oryzias latipes] ref|XP_004084106.1| histone H3.3 [Oryzias latipes] ref|XP_004271029.1| PREDICTED: histone H3.3 [Orcinus orca] ref|XP_004275531.1| PREDICTED: histone H3.3 [Orcinus orca] ref|XP_004374202.1| histone H3.3 [Trichechus manatus latirostris] ref|XP_004375943.1| histone H3.3 [Trichechus manatus latirostris] ref|XP_004394384.1| PREDICTED: histone H3.3 [Odobenus rosmarus divergens] ref|XP_004439612.1| PREDICTED: histone H3.3 [Ceratotherium simum simum] ref|XP_004450908.1| histone H3.3 [Dasypus novemcinctus] ref|XP_004476610.1| histone H3.3 [Dasypus novemcinctus] ref|XP_004557547.1| histone H3.3 [Maylandia zebra] ref|XP_004562520.1| histone H3.3 [Maylandia zebra] ref|XP_004567486.1| histone H3.3 [Maylandia zebra] ref|XP_004578655.1| PREDICTED: histone H3.3 [Ochotona princeps] ref|XP_004592960.1| PREDICTED: histone H3.3 [Ochotona princeps] ref|XP_004605482.1| PREDICTED: histone H3.3 [Sorex araneus] ref|XP_004641232.1| histone H3.3 [Octodon degus] ref|XP_004691090.1| PREDICTED: histone H3.3 [Condylura cristata] ref|XP_004693560.1| PREDICTED: histone H3.3 [Condylura cristata] ref|XP_004748948.1| PREDICTED: histone H3.3 [Mustela putorius furo] ref|XP_004761972.1| PREDICTED: histone H3.3 [Mustela putorius furo] ref|XP_004918516.1| PREDICTED: histone H3.3 [Xenopus tropicalis] ref|XP_004860763.1| histone H3.3 [Heterocephalus glaber] ref|XP_004999667.1| histone H3.3 [Cavia porcellus] ref|XP_005010211.1| histone H3.3 [Anas platyrhynchos] ref|XP_005069967.1| histone H3.3 [Mesocricetus auratus] ref|XP_005078192.1| histone H3.3 [Mesocricetus auratus] ref|XP_005056049.1| PREDICTED: histone H3.3 [Ficedula albicollis] ref|XP_005141451.1| PREDICTED: histone H3.3 [Melopsittacus undulatus] ref|XP_005243673.1| PREDICTED: histone H3.3 [Falco peregrinus] ref|XP_005289629.1| histone H3.3 [Chrysemys picta bellii] ref|XP_005297556.1| histone H3.3 [Chrysemys picta bellii] ref|XP_005349017.1| PREDICTED: histone H3.3 [Microtus ochrogaster] ref|XP_005350806.1| PREDICTED: histone H3.3 [Microtus ochrogaster] ref|XP_005332630.1| histone H3.3 [Ictidomys tridecemlineatus] ref|XP_005404549.1| PREDICTED: histone H3.3 [Chinchilla lanigera] ref|XP_005448024.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_005523348.1| PREDICTED: histone H3.3 [Pseudopodoces humilis] ref|XP_005526825.1| PREDICTED: histone H3.3 [Pseudopodoces humilis] ref|XP_005541064.1| PREDICTED: histone H3.3 [Macaca fascicularis] ref|XP_005585038.1| PREDICTED: histone H3.3 [Macaca fascicularis] ref|XP_005721939.1| PREDICTED: histone H3.3 [Pundamilia nyererei] ref|XP_005740175.1| PREDICTED: histone H3.3 [Pundamilia nyererei] ref|XP_005751764.1| PREDICTED: histone H3.3 [Pundamilia nyererei] ref|XP_005755275.1| PREDICTED: histone H3.3 [Pundamilia nyererei] ref|XP_005803299.1| histone H3.3 [Xiphophorus maculatus] ref|XP_005804582.1| histone H3.3 [Xiphophorus maculatus] ref|XP_005804584.1| histone H3.3 [Xiphophorus maculatus] ref|XP_005809674.1| histone H3.3 [Xiphophorus maculatus] ref|XP_005815160.1| histone H3.3 [Xiphophorus maculatus] ref|XP_005923872.1| PREDICTED: histone H3.3 [Haplochromis burtoni] ref|XP_005926645.1| PREDICTED: histone H3.3 [Haplochromis burtoni] ref|XP_005926646.1| PREDICTED: histone H3.3 [Haplochromis burtoni] ref|XP_005939565.1| PREDICTED: histone H3.3 [Haplochromis burtoni] ref|XP_005947848.1| PREDICTED: histone H3.3 [Haplochromis burtoni] ref|XP_005904534.1| PREDICTED: histone H3.3 [Bos mutus] ref|XP_005906357.1| PREDICTED: histone H3.3 [Bos mutus] ref|XP_005959145.1| PREDICTED: histone H3.3-like [Pantholops hodgsonii] ref|XP_005987867.1| PREDICTED: histone H3.3 isoform X2 [Latimeria chalumnae] ref|XP_006012509.1| PREDICTED: histone H3.3 [Latimeria chalumnae] ref|XP_006013918.1| PREDICTED: histone H3.3 [Latimeria chalumnae] ref|XP_006013919.1| PREDICTED: histone H3.3 [Latimeria chalumnae] ref|XP_006013920.1| PREDICTED: histone H3.3 [Latimeria chalumnae] ref|XP_006016625.1| PREDICTED: histone H3.3 [Alligator sinensis] ref|XP_006018341.1| PREDICTED: histone H3.3 [Alligator sinensis] ref|XP_006037004.1| PREDICTED: histone H3.3 [Alligator sinensis] ref|XP_005190680.1| PREDICTED: histone H3.3 [Musca domestica] ref|XP_006118112.1| PREDICTED: histone H3.3 [Pelodiscus sinensis] ref|XP_006136503.1| PREDICTED: histone H3.3 [Pelodiscus sinensis] ref|XP_006176524.1| PREDICTED: histone H3.3 [Camelus ferus] ref|XP_006188183.1| PREDICTED: histone H3.3 [Camelus ferus] ref|XP_006198891.1| PREDICTED: histone H3.3 [Vicugna pacos] ref|XP_006199457.1| PREDICTED: histone H3.3 [Vicugna pacos] ref|XP_006220073.1| PREDICTED: histone H3.3 [Vicugna pacos] ref|XP_006145860.1| PREDICTED: histone H3.3 [Tupaia chinensis] ref|XP_006157313.1| PREDICTED: histone H3.3 [Tupaia chinensis] ref|XP_006265010.1| PREDICTED: histone H3.3 [Alligator mississippiensis] ref|XP_006268823.1| PREDICTED: histone H3.3 [Alligator mississippiensis] ref|XP_006269304.1| PREDICTED: histone H3.3 [Alligator mississippiensis] ref|XP_006532311.1| PREDICTED: histone H3.3 isoform X1 [Mus musculus] ref|XP_006563134.1| PREDICTED: histone H3.3 [Apis mellifera] ref|XP_006563135.1| PREDICTED: histone H3.3 [Apis mellifera] ref|XP_006616689.1| PREDICTED: histone H3.3-like isoform X1 [Apis dorsata] ref|XP_006616690.1| PREDICTED: histone H3.3-like isoform X2 [Apis dorsata] ref|XP_006616691.1| PREDICTED: histone H3.3-like [Apis dorsata] ref|XP_006627520.1| PREDICTED: histone H3.3 [Lepisosteus oculatus] ref|XP_006635166.1| PREDICTED: histone H3.3 [Lepisosteus oculatus] ref|XP_006637126.1| PREDICTED: histone H3.3 [Lepisosteus oculatus] ref|XP_006797026.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi] ref|XP_006801113.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi] ref|XP_006808672.1| PREDICTED: histone H3.3-like [Neolamprologus brichardi] ref|XP_006748487.1| PREDICTED: histone H3.3-like [Leptonychotes weddellii] ref|XP_006750109.1| PREDICTED: histone H3.3-like isoform X1 [Leptonychotes weddellii] ref|XP_006886266.1| PREDICTED: histone H3.3-like [Elephantulus edwardii] ref|XP_006897815.1| PREDICTED: histone H3.3-like [Elephantulus edwardii] ref|XP_006869633.1| PREDICTED: histone H3.3-like [Chrysochloris asiatica] ref|XP_006912277.1| PREDICTED: histone H3.3 [Pteropus alecto] ref|XP_006993705.1| PREDICTED: histone H3.3 [Peromyscus maniculatus bairdii] ref|XP_007071767.1| PREDICTED: histone H3.3-like isoform X1 [Chelonia mydas] ref|XP_007072612.1| PREDICTED: histone H3.3-like [Chelonia mydas] ref|XP_007067371.1| PREDICTED: histone H3.3-like [Chelonia mydas] ref|XP_007099821.1| histone H3.3 [Physeter catodon] ref|XP_007128127.1| histone H3.3 [Physeter catodon] ref|XP_006045331.1| PREDICTED: histone H3.3-like [Bubalus bubalis] ref|XP_006046136.1| PREDICTED: histone H3.3-like isoform X1 [Bubalus bubalis] ref|XP_006046137.1| PREDICTED: histone H3.3-like isoform X2 [Bubalus bubalis] ref|XP_007167261.1| PREDICTED: histone H3.3-like [Balaenoptera acutorostrata scammoni] ref|XP_007185762.1| PREDICTED: histone H3.3-like [Balaenoptera acutorostrata scammoni] ref|XP_007240472.1| histone H3.3 [Astyanax mexicanus] ref|XP_007240473.1| histone H3.3 [Astyanax mexicanus] ref|XP_007240687.1| histone H3.3 [Astyanax mexicanus] ref|XP_007240688.1| histone H3.3 [Astyanax mexicanus] ref|XP_007256886.1| histone H3.3 [Astyanax mexicanus] ref|XP_007427042.1| PREDICTED: histone H3.3 [Python bivittatus] ref|XP_007436454.1| PREDICTED: histone H3.3 [Python bivittatus] ref|XP_007436455.1| PREDICTED: histone H3.3 [Python bivittatus] ref|XP_007454397.1| PREDICTED: histone H3.3-like isoform X1 [Lipotes vexillifer] ref|XP_007454398.1| PREDICTED: histone H3.3-like isoform X2 [Lipotes vexillifer] ref|XP_007454524.1| PREDICTED: histone H3.3-like [Lipotes vexillifer] ref|XP_007561070.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007556523.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007576700.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007576704.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007577897.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007577898.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007577900.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007577901.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_007534516.1| PREDICTED: histone H3.3 [Erinaceus europaeus] ref|XP_007536787.1| PREDICTED: histone H3.3 [Erinaceus europaeus] ref|XP_007670587.1| PREDICTED: histone H3.3 [Ornithorhynchus anatinus] ref|XP_007645983.1| PREDICTED: histone H3.3 isoform X1 [Cricetulus griseus] ref|XP_007626413.1| PREDICTED: histone H3.3 isoform X2 [Cricetulus griseus] ref|XP_007886957.1| PREDICTED: histone H3.3 [Callorhinchus milii] ref|XP_007896479.1| PREDICTED: histone H3.3 [Callorhinchus milii] ref|XP_007884068.1| PREDICTED: histone H3.3 [Callorhinchus milii] ref|XP_007935166.1| PREDICTED: histone H3.3 [Orycteropus afer afer] ref|XP_008009919.1| PREDICTED: histone H3.3 [Chlorocebus sabaeus] ref|XP_008047273.1| histone H3.3 [Carlito syrichta] ref|XP_008048990.1| histone H3.3 isoform X2 [Carlito syrichta] ref|XP_008186887.1| PREDICTED: histone H3.3 isoform X2 [Acyrthosiphon pisum] ref|XP_008188188.1| PREDICTED: histone H3.3 [Acyrthosiphon pisum] ref|XP_008153272.1| PREDICTED: histone H3.3 [Eptesicus fuscus] ref|XP_008197392.1| PREDICTED: histone H3.3 [Tribolium castaneum] ref|XP_008266274.1| PREDICTED: histone H3.3 isoform X1 [Oryctolagus cuniculus] ref|XP_008280859.1| PREDICTED: histone H3.3 [Stegastes partitus] ref|XP_008282544.1| PREDICTED: histone H3.3 [Stegastes partitus] ref|XP_008301911.1| PREDICTED: histone H3.3 [Stegastes partitus] ref|XP_008312429.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis] ref|XP_008312935.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis] ref|XP_008330716.1| PREDICTED: histone H3.3 [Cynoglossus semilaevis] ref|XP_008424338.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008424339.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008426585.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008434558.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008436003.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008436004.1| PREDICTED: histone H3.3 [Poecilia reticulata] ref|XP_008481972.1| PREDICTED: histone H3.3 isoform X1 [Diaphorina citri] ref|XP_008535873.1| PREDICTED: histone H3.3 [Equus przewalskii] ref|XP_008543017.1| PREDICTED: histone H3.3 [Equus przewalskii] ref|XP_008552508.1| PREDICTED: histone H3.3 [Microplitis demolitor] ref|XP_008552520.1| PREDICTED: histone H3.3 [Microplitis demolitor] ref|XP_008564309.1| PREDICTED: histone H3.3 [Galeopterus variegatus] ref|XP_008579016.1| PREDICTED: histone H3.3 [Galeopterus variegatus] ref|XP_008579017.1| PREDICTED: histone H3.3 [Galeopterus variegatus] ref|XP_008693497.1| PREDICTED: histone H3.3 [Ursus maritimus] ref|XP_008691998.1| PREDICTED: histone H3.3 [Ursus maritimus] ref|XP_008829603.1| PREDICTED: histone H3.3 [Nannospalax galili] ref|XP_009004243.1| PREDICTED: histone H3.3 [Callithrix jacchus] ref|XP_008964082.1| PREDICTED: histone H3.3 [Pan paniscus] ref|XP_009014580.1| hypothetical protein HELRODRAFT_185455 [Helobdella robusta] ref|XP_009064576.1| hypothetical protein LOTGIDRAFT_150994 [Lottia gigantea] ref|XP_009092019.1| PREDICTED: histone H3.3 [Serinus canaria] ref|XP_009194231.1| LOW QUALITY PROTEIN: histone H3.3-like [Papio anubis] ref|XP_009290278.1| histone H3.3 [Danio rerio] ref|XP_009474888.1| PREDICTED: histone H3.3 [Nipponia nippon] ref|XP_009566744.1| PREDICTED: histone H3.3 [Cuculus canorus] ref|XP_009636129.1| PREDICTED: histone H3.3 [Egretta garzetta] ref|XP_009861241.1| PREDICTED: histone H3.3 [Ciona intestinalis] ref|XP_010000944.1| PREDICTED: histone H3.3 [Chaetura pelagica] ref|XP_010217642.1| PREDICTED: histone H3.3 [Tinamus guttatus] ref|XP_010380324.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010360696.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010371199.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010376533.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010379416.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010385878.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010352126.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010356368.1| PREDICTED: histone H3.3 [Rhinopithecus roxellana] ref|XP_010565428.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus] ref|XP_010565429.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus] ref|XP_010576024.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576025.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576026.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576027.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576028.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576029.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576030.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576032.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010576033.1| PREDICTED: histone H3.3 isoform X1 [Haliaeetus leucocephalus] ref|XP_010577635.1| PREDICTED: histone H3.3 [Haliaeetus leucocephalus] ref|XP_010616712.1| PREDICTED: histone H3.3 [Fukomys damarensis] ref|XP_010616714.1| PREDICTED: histone H3.3 [Fukomys damarensis] ref|XP_010616715.1| PREDICTED: histone H3.3 [Fukomys damarensis] ref|XP_010595256.1| histone H3.3 [Loxodonta africana] ref|XP_010734542.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_010739542.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_010739544.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_010768027.1| PREDICTED: histone H3.3 [Notothenia coriiceps] ref|XP_010770452.1| PREDICTED: histone H3.3 [Notothenia coriiceps] ref|XP_010776070.1| PREDICTED: histone H3.3 [Notothenia coriiceps] ref|XP_010869098.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_010851172.1| PREDICTED: histone H3.3 [Bison bison bison] ref|XP_010887152.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_010890196.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_010896955.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_010972141.1| PREDICTED: histone H3.3 [Camelus bactrianus] ref|XP_010949055.1| PREDICTED: histone H3.3 [Camelus bactrianus] ref|XP_010990793.1| PREDICTED: histone H3.3 [Camelus dromedarius] ref|XP_010996709.1| PREDICTED: histone H3.3 [Camelus dromedarius] ref|XP_011069182.1| PREDICTED: histone H3.3 [Acromyrmex echinatior] ref|XP_011069183.1| PREDICTED: histone H3.3 [Acromyrmex echinatior] ref|XP_011069184.1| PREDICTED: histone H3.3 [Acromyrmex echinatior] ref|XP_011069185.1| PREDICTED: histone H3.3 [Acromyrmex echinatior] ref|XP_011141556.1| PREDICTED: histone H3.3 [Harpegnathos saltator] ref|XP_011141557.1| PREDICTED: histone H3.3 [Harpegnathos saltator] ref|XP_011141558.1| PREDICTED: histone H3.3 [Harpegnathos saltator] ref|XP_011158466.1| PREDICTED: histone H3.3 [Solenopsis invicta] ref|XP_011158467.1| PREDICTED: histone H3.3 [Solenopsis invicta] ref|XP_011158469.1| PREDICTED: histone H3.3 [Solenopsis invicta] ref|XP_011158470.1| PREDICTED: histone H3.3 [Solenopsis invicta] ref|XP_011158471.1| PREDICTED: histone H3.3 [Solenopsis invicta] ref|XP_011183434.1| PREDICTED: histone H3.3 [Zeugodacus cucurbitae] ref|XP_011206404.1| PREDICTED: histone H3.3 [Bactrocera dorsalis] ref|XP_011265432.1| PREDICTED: histone H3.3 [Camponotus floridanus] ref|XP_003997209.3| histone H3.3 [Felis catus] ref|XP_011298455.1| PREDICTED: histone H3.3 [Fopius arisanus] ref|XP_011298462.1| PREDICTED: histone H3.3 isoform X2 [Fopius arisanus] ref|XP_011346345.1| PREDICTED: histone H3.3 [Ooceraea biroi] ref|XP_011346346.1| PREDICTED: histone H3.3 [Ooceraea biroi] ref|XP_011346347.1| PREDICTED: histone H3.3 [Ooceraea biroi] ref|XP_011359139.1| histone H3.3 [Pteropus vampyrus] ref|XP_011360255.1| histone H3.3 [Pteropus vampyrus] ref|XP_011441839.1| PREDICTED: histone H3.3 [Crassostrea gigas] ref|XP_011420805.1| PREDICTED: histone H3.3 [Crassostrea gigas] ref|XP_011503189.1| PREDICTED: histone H3.3 [Ceratosolen solmsi marchali] ref|XP_011503190.1| PREDICTED: histone H3.3 [Ceratosolen solmsi marchali] ref|XP_011583983.1| PREDICTED: histone H3.3 [Aquila chrysaetos canadensis] ref|XP_011585409.1| PREDICTED: histone H3.3 [Aquila chrysaetos canadensis] ref|XP_011598108.1| PREDICTED: histone H3.3 [Aquila chrysaetos canadensis] ref|XP_011557760.1| PREDICTED: histone H3.3 [Plutella xylostella] ref|XP_011635839.1| PREDICTED: histone H3.3 [Pogonomyrmex barbatus] ref|XP_011635840.1| PREDICTED: histone H3.3 [Pogonomyrmex barbatus] ref|XP_011635841.1| PREDICTED: histone H3.3 [Pogonomyrmex barbatus] ref|XP_011707504.1| PREDICTED: histone H3.3 [Wasmannia auropunctata] ref|XP_011707505.1| PREDICTED: histone H3.3 [Wasmannia auropunctata] ref|XP_011707509.1| PREDICTED: histone H3.3 [Wasmannia auropunctata] ref|XP_011707511.1| PREDICTED: histone H3.3 [Wasmannia auropunctata] ref|XP_011836348.1| PREDICTED: histone H3.3 isoform X2 [Mandrillus leucophaeus] ref|XP_011836434.1| PREDICTED: histone H3.3 isoform X2 [Mandrillus leucophaeus] ref|XP_011876510.1| PREDICTED: histone H3.3 [Vollenhovia emeryi] ref|XP_011876511.1| PREDICTED: histone H3.3 [Vollenhovia emeryi] ref|XP_011925547.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011804341.1| PREDICTED: histone H3.3 isoform X1 [Colobus angolensis palliatus] ref|XP_011804342.1| PREDICTED: histone H3.3 isoform X1 [Colobus angolensis palliatus] ref|XP_011804343.1| PREDICTED: histone H3.3 isoform X1 [Colobus angolensis palliatus] ref|XP_011804344.1| PREDICTED: histone H3.3 isoform X1 [Colobus angolensis palliatus] ref|XP_011734322.1| PREDICTED: histone H3.3 [Macaca nemestrina] ref|XP_011744414.1| PREDICTED: histone H3.3 [Macaca nemestrina] ref|XP_011932676.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011758640.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3-like [Macaca nemestrina] ref|XP_011895905.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011895906.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011897852.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011897853.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_011718175.1| PREDICTED: histone H3.3 [Macaca nemestrina] ref|XP_011907339.1| PREDICTED: histone H3.3 [Cercocebus atys] ref|XP_012063565.1| PREDICTED: histone H3.3 [Atta cephalotes] ref|XP_012063566.1| PREDICTED: histone H3.3 [Atta cephalotes] ref|XP_011965131.1| PREDICTED: histone H3.3 isoform X3 [Ovis aries musimon] ref|XP_011966071.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3 isoform X2 [Ovis aries musimon] ref|XP_012234151.1| PREDICTED: histone H3.3 [Linepithema humile] ref|XP_012234152.1| PREDICTED: histone H3.3 [Linepithema humile] ref|XP_012234153.1| PREDICTED: histone H3.3 [Linepithema humile] ref|XP_012234154.1| PREDICTED: histone H3.3 [Linepithema humile] ref|XP_012234155.1| PREDICTED: histone H3.3 [Linepithema humile] ref|XP_012244001.1| histone H3.3 [Bombus impatiens] ref|XP_012244013.1| histone H3.3 [Bombus impatiens] ref|XP_012244017.1| histone H3.3 [Bombus impatiens] ref|XP_012269418.1| histone H3.3 [Athalia rosae] ref|XP_012258866.1| histone H3.3 [Athalia rosae] ref|XP_012273469.1| histone H3.3 [Orussus abietinus] ref|XP_012307212.1| histone H3.3 [Aotus nancymaae] ref|XP_012315230.1| histone H3.3 [Aotus nancymaae] ref|XP_012343003.1| PREDICTED: histone H3.3 [Apis florea] ref|XP_012343004.1| PREDICTED: histone H3.3 [Apis florea] ref|XP_012362020.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_012362021.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_012362022.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_012362023.1| PREDICTED: histone H3.3 isoform X1 [Nomascus leucogenys] ref|XP_012368149.1| histone H3.3 [Octodon degus] ref|XP_012415733.1| PREDICTED: histone H3.3 [Odobenus rosmarus divergens] ref|XP_012499830.1| PREDICTED: histone H3.3 isoform X1 [Propithecus coquereli] ref|XP_012499831.1| PREDICTED: histone H3.3 isoform X2 [Propithecus coquereli] ref|XP_012517709.1| PREDICTED: histone H3.3 [Propithecus coquereli] ref|XP_012529472.1| PREDICTED: histone H3.3 [Monomorium pharaonis] ref|XP_012529473.1| PREDICTED: histone H3.3 [Monomorium pharaonis] ref|XP_012529474.1| PREDICTED: histone H3.3 [Monomorium pharaonis] ref|XP_012529475.1| PREDICTED: histone H3.3 [Monomorium pharaonis] ref|XP_012634299.1| histone H3.3 [Microcebus murinus] ref|XP_012606772.1| histone H3.3 [Microcebus murinus] ref|XP_012674227.1| PREDICTED: histone H3.3 [Clupea harengus] ref|XP_012678689.1| PREDICTED: histone H3.3 isoform X2 [Clupea harengus] ref|XP_012694705.1| PREDICTED: histone H3.3 [Clupea harengus] ref|XP_012718583.1| histone H3.3 [Fundulus heteroclitus] ref|XP_012719554.1| histone H3.3 [Fundulus heteroclitus] ref|XP_012723570.1| histone H3.3 [Fundulus heteroclitus] ref|XP_012728063.1| histone H3.3 [Fundulus heteroclitus] ref|XP_012728065.1| histone H3.3 [Fundulus heteroclitus] ref|XP_012777767.1| histone H3.3 [Maylandia zebra] ref|XP_012777768.1| histone H3.3 [Maylandia zebra] ref|XP_012786403.1| PREDICTED: histone H3.3 [Ochotona princeps] ref|XP_012859399.1| PREDICTED: histone H3.3 [Echinops telfairi] ref|XP_012893322.1| PREDICTED: histone H3.3 [Dipodomys ordii] ref|XP_012933635.1| histone H3.3 [Heterocephalus glaber] ref|XP_012933636.1| histone H3.3 [Heterocephalus glaber] ref|XP_012990765.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_013114376.1| PREDICTED: histone H3.3 [Stomoxys calcitrans] ref|XP_013114377.1| PREDICTED: histone H3.3 [Stomoxys calcitrans] ref|XP_013086290.1| PREDICTED: histone H3.3 [Biomphalaria glabrata] ref|XP_013128312.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_013128318.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_013199850.1| PREDICTED: histone H3.3 [Amyelois transitella] ref|XP_013297213.1| core histone H2A/H2B/H3/H4 [Necator americanus] ref|XP_013301891.1| core histone H2A/H2B/H3/H4 [Necator americanus] ref|XP_013398416.1| histone H3.3 [Lingula anatina] ref|XP_013795791.1| PREDICTED: histone H3.3 [Apteryx australis mantelli] ref|XP_013797333.1| PREDICTED: histone H3.3 [Apteryx australis mantelli] ref|XP_013809473.1| PREDICTED: histone H3.3 [Apteryx australis mantelli] ref|XP_013809474.1| PREDICTED: histone H3.3 [Apteryx australis mantelli] ref|XP_013773710.1| histone H3.3 [Limulus polyphemus] ref|XP_013775660.1| histone H3.3 [Limulus polyphemus] ref|XP_013775661.1| histone H3.3 [Limulus polyphemus] ref|XP_013775662.1| histone H3.3 [Limulus polyphemus] ref|XP_013776214.1| histone H3.3 [Limulus polyphemus] ref|XP_013777168.1| histone H3.3 [Limulus polyphemus] ref|XP_013782017.1| histone H3.3 [Limulus polyphemus] ref|XP_013786859.1| histone H3.3 [Limulus polyphemus] ref|XP_013914121.1| PREDICTED: histone H3.3 [Thamnophis sirtalis] ref|XP_013930352.1| PREDICTED: histone H3.3 [Thamnophis sirtalis] ref|XP_013930353.1| PREDICTED: histone H3.3 [Thamnophis sirtalis] ref|XP_013930590.1| PREDICTED: histone H3.3 [Thamnophis sirtalis] ref|XP_013870443.1| PREDICTED: histone H3.3 [Austrofundulus limnaeus] ref|XP_013879174.1| PREDICTED: histone H3.3 [Austrofundulus limnaeus] ref|XP_013885059.1| PREDICTED: histone H3.3 [Austrofundulus limnaeus] ref|XP_013887037.1| PREDICTED: histone H3.3 [Austrofundulus limnaeus] ref|XP_014053180.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014069423.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014069424.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014069425.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_013992577.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014012397.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014012398.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014013585.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014014405.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014014406.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014017794.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014017795.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014017796.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014034978.1| PREDICTED: histone H3.3 [Salmo salar] ref|XP_014086012.1| PREDICTED: histone H3.3 [Bactrocera oleae] ref|XP_014086013.1| PREDICTED: histone H3.3 [Bactrocera oleae] ref|XP_014213658.1| histone H3.3 [Copidosoma floridanum] ref|XP_014213659.1| histone H3.3 [Copidosoma floridanum] ref|XP_014241070.1| histone H3.3 [Cimex lectularius] ref|XP_014241074.1| histone H3.3 [Cimex lectularius] ref|XP_014268334.1| histone H3.3 [Maylandia zebra] ref|XP_014270580.1| PREDICTED: histone H3.3 [Halyomorpha halys] ref|XP_014270581.1| PREDICTED: histone H3.3 [Halyomorpha halys] ref|XP_014270582.1| PREDICTED: histone H3.3 [Halyomorpha halys] ref|XP_014301359.1| histone H3.3 [Myotis lucifugus] ref|XP_014301360.1| histone H3.3 [Myotis lucifugus] ref|XP_014348778.1| PREDICTED: histone H3.3 isoform X2 [Latimeria chalumnae] ref|XP_014348784.1| PREDICTED: histone H3.3 isoform X2 [Latimeria chalumnae] ref|XP_014347324.1| PREDICTED: histone H3.3 [Latimeria chalumnae] ref|XP_014367732.1| PREDICTED: histone H3.3 [Papilio machaon] ref|XP_014428132.1| PREDICTED: histone H3.3 [Pelodiscus sinensis] ref|XP_014435739.1| PREDICTED: histone H3.3 [Pelodiscus sinensis] ref|XP_014467498.1| PREDICTED: histone H3.3 [Dinoponera quadriceps] ref|XP_014467499.1| PREDICTED: histone H3.3 [Dinoponera quadriceps] ref|XP_014616926.1| PREDICTED: histone H3.3 [Polistes canadensis] ref|XP_014616938.1| PREDICTED: histone H3.3 [Polistes canadensis] ref|XP_014616947.1| PREDICTED: histone H3.3 [Polistes canadensis] ref|XP_014644756.1| PREDICTED: histone H3.3 [Ceratotherium simum simum] ref|XP_014663187.1| PREDICTED: histone H3.3 [Priapulus caudatus] ref|XP_014695341.1| PREDICTED: histone H3.3 [Equus asinus] ref|XP_014717865.1| PREDICTED: histone H3.3 [Equus asinus] ref|XP_014732955.1| PREDICTED: histone H3.3 [Sturnus vulgaris] ref|XP_014744637.1| PREDICTED: histone H3.3 [Sturnus vulgaris] ref|XP_014806874.1| PREDICTED: histone H3.3 [Calidris pugnax] ref|XP_014806369.1| PREDICTED: histone H3.3 [Calidris pugnax] ref|XP_014772802.1| PREDICTED: histone H3.3 [Octopus bimaculoides] ref|XP_014787786.1| PREDICTED: histone H3.3 [Octopus bimaculoides] ref|XP_014871381.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014871393.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014836307.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014836308.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014841936.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014889253.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014895473.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014895474.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014822973.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014872373.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014825808.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014825809.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014881743.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014881744.1| PREDICTED: histone H3.3 [Poecilia latipinna] ref|XP_014834560.1| PREDICTED: histone H3.3 [Poecilia mexicana] ref|XP_014970664.1| PREDICTED: histone H3.3 [Macaca mulatta] ref|XP_014981108.1| PREDICTED: histone H3.3 [Macaca mulatta] ref|XP_014975881.1| PREDICTED: histone H3.3 [Macaca mulatta] ref|XP_014975882.1| PREDICTED: histone H3.3 [Macaca mulatta] ref|XP_015032659.1| histone H3.3 [Drosophila willistoni] ref|XP_015118788.1| PREDICTED: histone H3.3 [Diachasma alloeum] ref|XP_015118903.1| PREDICTED: histone H3.3 [Diachasma alloeum] ref|XP_015172183.1| PREDICTED: histone H3.3 [Polistes dominula] ref|XP_015172184.1| PREDICTED: histone H3.3 [Polistes dominula] ref|XP_015172185.1| PREDICTED: histone H3.3 [Polistes dominula] ref|XP_015196190.1| PREDICTED: histone H3.3 [Lepisosteus oculatus] ref|XP_015215540.1| PREDICTED: histone H3.3 [Lepisosteus oculatus] ref|XP_015251385.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015230629.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015238393.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015245618.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015245619.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015245620.1| PREDICTED: histone H3.3 [Cyprinodon variegatus] ref|XP_015284463.1| PREDICTED: histone H3.3 [Gekko japonicus] ref|XP_015269967.1| PREDICTED: histone H3.3 [Gekko japonicus] ref|XP_015279774.1| PREDICTED: histone H3.3 [Gekko japonicus] ref|XP_015279775.1| PREDICTED: histone H3.3 [Gekko japonicus] ref|XP_015339070.1| PREDICTED: histone H3.3 [Marmota marmota marmota] ref|XP_015359661.1| PREDICTED: histone H3.3 [Marmota marmota marmota] ref|XP_015367919.1| PREDICTED: histone H3.3 [Diuraphis noxia] ref|XP_015371377.1| PREDICTED: histone H3.3 [Diuraphis noxia] ref|XP_015399949.1| PREDICTED: histone H3.3 [Panthera tigris altaica] ref|XP_015434156.1| PREDICTED: histone H3.3 [Dufourea novaeangliae] ref|XP_015434157.1| PREDICTED: histone H3.3 [Dufourea novaeangliae] ref|XP_015418760.1| PREDICTED: histone H3.3 [Myotis davidii] ref|XP_015509180.1| PREDICTED: histone H3.3 [Neodiprion lecontei] ref|XP_015509181.1| PREDICTED: histone H3.3 [Neodiprion lecontei] ref|XP_015478189.1| PREDICTED: histone H3.3 [Parus major] ref|XP_015501584.1| PREDICTED: histone H3.3 [Parus major] ref|XP_015588685.1| PREDICTED: histone H3.3 [Cephus cinctus] ref|XP_015590758.1| PREDICTED: histone H3.3 [Cephus cinctus] ref|XP_015590759.1| PREDICTED: histone H3.3 [Cephus cinctus] ref|XP_015674626.1| PREDICTED: histone H3.3 [Protobothrops mucrosquamatus] ref|XP_015675669.1| PREDICTED: histone H3.3 [Protobothrops mucrosquamatus] ref|XP_015680070.1| PREDICTED: histone H3.3 [Protobothrops mucrosquamatus] ref|XP_015680071.1| PREDICTED: histone H3.3 [Protobothrops mucrosquamatus] ref|XP_015743777.1| PREDICTED: histone H3.3 [Python bivittatus] ref|XP_015781882.1| PREDICTED: histone H3.3 [Tetranychus urticae] ref|XP_015816126.1| PREDICTED: histone H3.3 [Nothobranchius furzeri] ref|XP_015818872.1| PREDICTED: histone H3.3 [Nothobranchius furzeri] ref|XP_015819261.1| PREDICTED: histone H3.3 isoform X2 [Nothobranchius furzeri] ref|XP_015796641.1| PREDICTED: histone H3.3 [Nothobranchius furzeri] ref|XP_015796642.1| PREDICTED: histone H3.3 [Nothobranchius furzeri] ref|XP_015796643.1| PREDICTED: histone H3.3 [Nothobranchius furzeri] ref|XP_015848478.1| PREDICTED: histone H3.3 [Peromyscus maniculatus bairdii] ref|XP_015918384.1| histone H3.3 [Parasteatoda tepidariorum] ref|XP_015918385.1| histone H3.3 [Parasteatoda tepidariorum] ref|XP_015918386.1| histone H3.3 [Parasteatoda tepidariorum] ref|XP_015983388.1| PREDICTED: histone H3.3 [Rousettus aegyptiacus] ref|XP_016012957.1| PREDICTED: histone H3.3 [Rousettus aegyptiacus] ref|XP_016038650.1| uncharacterized protein Dsimw501_GD27984 [Drosophila simulans] ref|XP_016067936.1| PREDICTED: histone H3.3 [Miniopterus natalensis] ref|XP_016076697.1| PREDICTED: histone H3.3 [Miniopterus natalensis] ref|XP_016092113.1| PREDICTED: histone H3.3 isoform X1 [Sinocyclocheilus grahami] ref|XP_016092122.1| PREDICTED: histone H3.3 isoform X2 [Sinocyclocheilus grahami] ref|XP_016142283.1| PREDICTED: histone H3.3 [Sinocyclocheilus grahami] ref|XP_016142284.1| PREDICTED: histone H3.3 [Sinocyclocheilus grahami] ref|XP_016084660.1| PREDICTED: histone H3.3 [Sinocyclocheilus grahami] ref|XP_016106522.1| PREDICTED: histone H3.3 [Sinocyclocheilus grahami] ref|XP_016106523.1| PREDICTED: histone H3.3 [Sinocyclocheilus grahami] ref|XP_016286139.1| PREDICTED: histone H3.3 [Monodelphis domestica] ref|XP_016361457.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016361458.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016309278.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016309279.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016309280.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016314323.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016324151.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016324152.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016324153.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016327549.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016327550.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016330473.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016348327.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016348328.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016416025.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016357315.1| PREDICTED: histone H3.3 [Sinocyclocheilus anshuiensis] ref|XP_016430561.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016430562.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016370789.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016370790.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016370959.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016370960.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016370962.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016380308.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016380315.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016382042.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016382043.1| PREDICTED: histone H3.3 [Sinocyclocheilus rhinocerous] ref|XP_016531535.1| PREDICTED: histone H3.3 [Poecilia formosa] ref|XP_003506879.3| PREDICTED: histone H3.3 isoform X1 [Cricetulus griseus] ref|XP_016850307.1| PREDICTED: histone H3.3 [Anolis carolinensis] ref|XP_016805313.1| histone H3.3 [Pan troglodytes] ref|XP_016916623.1| PREDICTED: histone H3.3 [Apis cerana] ref|XP_016916624.1| PREDICTED: histone H3.3 [Apis cerana] ref|XP_016916625.1| PREDICTED: histone H3.3 [Apis cerana] ref|XP_016945604.1| PREDICTED: histone H3.3 [Drosophila suzukii] ref|XP_016939005.1| PREDICTED: histone H3.3 [Drosophila suzukii] ref|XP_016939006.1| PREDICTED: histone H3.3 [Drosophila suzukii] ref|XP_016947991.1| PREDICTED: histone H3.3 [Drosophila biarmipes] ref|XP_016947992.1| PREDICTED: histone H3.3 [Drosophila biarmipes] ref|XP_017145391.1| PREDICTED: histone H3.3 [Drosophila miranda] ref|XP_017038600.1| PREDICTED: histone H3.3 [Drosophila kikkawai] ref|XP_017063146.1| PREDICTED: histone H3.3 [Drosophila eugracilis] ref|XP_017064008.1| PREDICTED: histone H3.3 [Drosophila eugracilis] ref|XP_017064009.1| PREDICTED: histone H3.3 [Drosophila eugracilis] ref|XP_016973252.1| PREDICTED: histone H3.3 [Drosophila rhopaloa] ref|XP_016995927.1| PREDICTED: histone H3.3 [Drosophila takahashii] ref|XP_016996254.1| PREDICTED: histone H3.3 [Drosophila takahashii] ref|XP_016996255.1| PREDICTED: histone H3.3 [Drosophila takahashii] ref|XP_017042067.1| PREDICTED: histone H3.3 [Drosophila ficusphila] ref|XP_017043849.1| PREDICTED: histone H3.3 [Drosophila ficusphila] ref|XP_017113196.1| PREDICTED: histone H3.3 [Drosophila elegans] ref|XP_017113197.1| PREDICTED: histone H3.3 [Drosophila elegans] ref|XP_017113198.1| PREDICTED: histone H3.3 [Drosophila elegans] ref|XP_016956757.1| PREDICTED: histone H3.3 [Drosophila biarmipes] ref|XP_017152552.1| PREDICTED: histone H3.3 [Drosophila miranda] ref|XP_017094606.1| PREDICTED: histone H3.3 [Drosophila bipectinata] ref|XP_017094607.1| PREDICTED: histone H3.3 [Drosophila bipectinata] ref|XP_017095504.1| PREDICTED: histone H3.3 [Drosophila bipectinata] ref|XP_016984659.1| PREDICTED: histone H3.3 [Drosophila rhopaloa] ref|XP_016984660.1| PREDICTED: histone H3.3 [Drosophila rhopaloa] ref|XP_017034734.1| PREDICTED: histone H3.3 [Drosophila kikkawai] ref|XP_017034735.1| PREDICTED: histone H3.3 [Drosophila kikkawai] ref|XP_017130341.1| PREDICTED: histone H3.3 [Drosophila elegans] ref|XP_017203252.1| PREDICTED: histone H3.3 [Oryctolagus cuniculus] ref|XP_017209248.1| H3 histone, family 3A isoform X1 [Danio rerio] ref|XP_017271631.1| PREDICTED: histone H3.3 [Kryptolebias marmoratus] ref|XP_017283849.1| PREDICTED: histone H3.3 [Kryptolebias marmoratus] ref|XP_017290848.1| PREDICTED: histone H3.3 [Kryptolebias marmoratus] ref|XP_017290849.1| PREDICTED: histone H3.3 [Kryptolebias marmoratus] ref|XP_017303499.1| PREDICTED: histone H3.3 isoform X2 [Diaphorina citri] ref|XP_017303505.1| PREDICTED: histone H3.3 isoform X3 [Diaphorina citri] ref|XP_017303507.1| PREDICTED: histone H3.3 isoform X2 [Diaphorina citri] ref|XP_017299181.1| PREDICTED: histone H3.3 [Diaphorina citri] ref|XP_017321860.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017350842.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017310133.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017310134.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017310135.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017315073.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017315074.1| PREDICTED: histone H3.3 [Ictalurus punctatus] ref|XP_017381928.1| PREDICTED: histone H3.3 [Cebus capucinus imitator] ref|XP_017391266.1| PREDICTED: histone H3.3 isoform X2 [Cebus capucinus imitator] ref|XP_017474382.1| PREDICTED: histone H3.3 [Rhagoletis zephyria] ref|XP_017494520.1| PREDICTED: histone H3.3 [Rhagoletis zephyria] ref|XP_017494968.1| PREDICTED: histone H3.3 [Rhagoletis zephyria] ref|XP_017530303.1| PREDICTED: histone H3.3 [Manis javanica] ref|XP_017524722.1| PREDICTED: histone H3.3 [Manis javanica] ref|XP_017524723.1| PREDICTED: histone H3.3 [Manis javanica] ref|XP_017556303.1| PREDICTED: histone H3.3 [Pygocentrus nattereri] ref|XP_017563054.1| PREDICTED: histone H3.3 [Pygocentrus nattereri] ref|XP_017563055.1| PREDICTED: histone H3.3 [Pygocentrus nattereri] ref|XP_017569369.1| PREDICTED: histone H3.3 [Pygocentrus nattereri] ref|XP_017542144.1| PREDICTED: histone H3.3 [Pygocentrus nattereri] ref|XP_017668379.1| PREDICTED: histone H3.3 [Lepidothrix coronata] ref|XP_017688489.1| PREDICTED: histone H3.3 [Lepidothrix coronata] ref|XP_017709841.1| PREDICTED: histone H3.3 [Rhinopithecus bieti] ref|XP_017740187.1| PREDICTED: histone H3.3 [Rhinopithecus bieti] ref|XP_017760616.1| PREDICTED: histone H3.3 [Eufriesea mexicana] ref|XP_017760617.1| PREDICTED: histone H3.3 [Eufriesea mexicana] ref|XP_017760618.1| PREDICTED: histone H3.3 [Eufriesea mexicana] ref|XP_017770925.1| PREDICTED: histone H3.3 [Nicrophorus vespilloides] ref|XP_017770926.1| PREDICTED: histone H3.3 [Nicrophorus vespilloides] ref|XP_017797793.1| PREDICTED: histone H3.3 [Habropoda laboriosa] ref|XP_017797795.1| PREDICTED: histone H3.3 [Habropoda laboriosa] ref|XP_017853815.1| PREDICTED: histone H3.3 [Drosophila busckii] ref|XP_017859728.1| PREDICTED: histone H3.3 [Drosophila arizonae] ref|XP_017871499.1| PREDICTED: histone H3.3 [Drosophila arizonae] ref|XP_017852587.1| PREDICTED: histone H3.3 [Drosophila busckii] ref|XP_017884545.1| PREDICTED: histone H3.3 [Ceratina calcarata] ref|XP_017884546.1| PREDICTED: histone H3.3 [Ceratina calcarata] ref|XP_017954131.1| PREDICTED: histone H3.3 [Drosophila navojoa] ref|XP_017964172.1| PREDICTED: histone H3.3 [Drosophila navojoa] ref|XP_017928796.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3 [Manacus vitellinus] ref|XP_017915713.1| PREDICTED: histone H3.3 [Capra hircus] ref|XP_017919285.1| PREDICTED: histone H3.3 [Capra hircus] ref|XP_018015766.1| PREDICTED: histone H3.3 [Hyalella azteca] ref|XP_018019358.1| PREDICTED: histone H3.3 [Hyalella azteca] ref|XP_018055106.1| PREDICTED: histone H3.3 [Atta colombica] ref|XP_018055114.1| PREDICTED: histone H3.3 [Atta colombica] ref|XP_018055126.1| PREDICTED: histone H3.3 [Atta colombica] ref|XP_018118148.1| PREDICTED: histone H3.3 [Xenopus laevis] ref|XP_018119714.1| PREDICTED: histone H3.3 isoform X1 [Xenopus laevis] ref|XP_018091870.1| PREDICTED: histone H3.3 [Xenopus laevis] ref|XP_018313040.1| PREDICTED: histone H3.3 [Trachymyrmex zeteki] ref|XP_018313048.1| PREDICTED: histone H3.3 [Trachymyrmex zeteki] ref|XP_018313062.1| PREDICTED: histone H3.3 [Trachymyrmex zeteki] ref|XP_018330255.1| PREDICTED: histone H3.3 [Agrilus planipennis] ref|XP_018346731.1| PREDICTED: histone H3.3 [Trachymyrmex septentrionalis] ref|XP_018346732.1| PREDICTED: histone H3.3 [Trachymyrmex septentrionalis] ref|XP_018346733.1| PREDICTED: histone H3.3 [Trachymyrmex septentrionalis] ref|XP_018371440.1| PREDICTED: histone H3.3 [Trachymyrmex cornetzi] ref|XP_018371441.1| PREDICTED: histone H3.3 [Trachymyrmex cornetzi] ref|XP_018371442.1| PREDICTED: histone H3.3 [Trachymyrmex cornetzi] ref|XP_018371443.1| PREDICTED: histone H3.3 [Trachymyrmex cornetzi] ref|XP_018398174.1| PREDICTED: histone H3.3 [Cyphomyrmex costatus] ref|XP_018398176.1| PREDICTED: histone H3.3 [Cyphomyrmex costatus] ref|XP_018398177.1| PREDICTED: histone H3.3 [Cyphomyrmex costatus] ref|XP_018427137.1| PREDICTED: histone H3.3 [Nanorana parkeri] ref|XP_018423862.1| PREDICTED: histone H3.3 [Nanorana parkeri] ref|XP_018417049.1| PREDICTED: histone H3.3 [Nanorana parkeri] ref|XP_018531544.1| PREDICTED: histone H3.3 [Lates calcarifer] ref|XP_018531545.1| PREDICTED: histone H3.3 [Lates calcarifer] ref|XP_018537306.1| PREDICTED: histone H3.3 [Lates calcarifer] ref|XP_018547157.1| PREDICTED: histone H3.3 [Lates calcarifer] ref|XP_018515714.1| PREDICTED: histone H3.3 [Lates calcarifer] ref|XP_018575034.1| histone H3.3 [Anoplophora glabripennis] ref|XP_018612713.1| PREDICTED: histone H3.3 [Scleropages formosus] ref|XP_018612722.1| PREDICTED: histone H3.3 [Scleropages formosus] ref|XP_018590542.1| PREDICTED: histone H3.3 [Scleropages formosus] ref|XP_018617125.1| PREDICTED: histone H3.3 [Scleropages formosus] ref|XP_018804829.1| PREDICTED: histone H3.3 [Bactrocera latifrons] ref|XP_018899168.1| PREDICTED: histone H3.3 [Bemisia tabaci] ref|XP_018908821.1| PREDICTED: histone H3.3 [Bemisia tabaci] ref|XP_018908822.1| PREDICTED: histone H3.3 [Bemisia tabaci] ref|XP_018908823.1| PREDICTED: histone H3.3 [Bemisia tabaci] ref|XP_018928637.1| PREDICTED: histone H3.3 [Cyprinus carpio] ref|XP_018941213.1| PREDICTED: histone H3.3 [Cyprinus carpio] ref|XP_018964753.1| PREDICTED: histone H3.3 isoform X1 [Cyprinus carpio] ref|XP_018964754.1| PREDICTED: histone H3.3 isoform X2 [Cyprinus carpio] ref|XP_018955939.1| PREDICTED: histone H3.3 [Cyprinus carpio] ref|XP_010611509.2| PREDICTED: histone H3.3 [Fukomys damarensis] ref|XP_019119054.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_019123407.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_019123408.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_019128305.1| PREDICTED: histone H3.3 [Larimichthys crocea] ref|XP_019223220.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_019223221.1| PREDICTED: histone H3.3 [Oreochromis niloticus] ref|XP_019277539.1| PREDICTED: histone H3.3 [Panthera pardus] ref|XP_019321740.1| PREDICTED: histone H3.3 [Panthera pardus] ref|XP_019358909.1| PREDICTED: histone H3.3 [Gavialis gangeticus] ref|XP_019372086.1| PREDICTED: histone H3.3 [Gavialis gangeticus] ref|XP_019543073.1| PREDICTED: histone H3.3 [Aedes albopictus] ref|XP_019551983.1| PREDICTED: histone H3.3 [Aedes albopictus] ref|XP_019522680.1| PREDICTED: histone H3.3 [Hipposideros armiger] ref|XP_019499967.1| PREDICTED: histone H3.3 [Hipposideros armiger] ref|XP_019398137.1| PREDICTED: histone H3.3 [Crocodylus porosus] ref|XP_019520692.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3-like [Hipposideros armiger] ref|XP_019405100.1| PREDICTED: histone H3.3 [Crocodylus porosus] ref|XP_019586467.1| PREDICTED: histone H3.3 [Rhinolophus sinicus] ref|XP_019601181.1| PREDICTED: histone H3.3 [Rhinolophus sinicus] ref|XP_019642898.1| PREDICTED: histone H3.3 [Branchiostoma belcheri] ref|XP_019647944.1| PREDICTED: histone H3.3 [Branchiostoma belcheri] ref|XP_019721182.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019749340.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019713282.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019713284.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019713285.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019717114.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019717115.1| PREDICTED: histone H3.3 [Hippocampus comes] ref|XP_019760311.1| PREDICTED: histone H3.3 [Dendroctonus ponderosae] ref|XP_019832208.1| PREDICTED: histone H3.3 [Bos indicus] ref|XP_019836582.1| PREDICTED: histone H3.3 [Bos indicus] ref|XP_019776084.1| PREDICTED: histone H3.3 [Tursiops truncatus] ref|XP_019867859.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3-like [Aethina tumida] ref|XP_019894871.1| PREDICTED: histone H3.3 [Musca domestica] ref|XP_019902611.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_019902621.1| PREDICTED: histone H3.3 [Esox lucius] ref|XP_019938801.1| PREDICTED: histone H3.3 [Paralichthys olivaceus] ref|XP_019941394.1| PREDICTED: histone H3.3 [Paralichthys olivaceus] ref|XP_019950586.1| PREDICTED: histone H3.3 isoform X1 [Paralichthys olivaceus] ref|XP_019950587.1| PREDICTED: histone H3.3 isoform X1 [Paralichthys olivaceus] ref|XP_019950588.1| PREDICTED: histone H3.3 isoform X2 [Paralichthys olivaceus] ref|XP_019968301.1| PREDICTED: histone H3.3 [Paralichthys olivaceus] ref|XP_020027103.1| histone H3.3 [Castor canadensis] ref|XP_020034399.1| histone H3.3 [Castor canadensis] ref|XP_020294911.1| histone H3.3 [Pseudomyrmex gracilis] ref|XP_020294912.1| histone H3.3 [Pseudomyrmex gracilis] ref|XP_020294913.1| histone H3.3 [Pseudomyrmex gracilis] ref|XP_020294914.1| histone H3.3 [Pseudomyrmex gracilis] ref|XP_020341358.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020358558.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020358559.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020358560.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020363421.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020363422.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020363423.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020309008.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020309301.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020309302.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020316080.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020316081.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020316082.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020316406.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020316407.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020319415.1| histone H3.3 [Oncorhynchus kisutch] ref|XP_020375176.1| histone H3.3 [Rhincodon typus] ref|XP_020375177.1| histone H3.3 [Rhincodon typus] ref|XP_020378092.1| histone H3.3 [Rhincodon typus] ref|XP_020378559.1| histone H3.3 [Rhincodon typus] ref|XP_020390937.1| histone H3.3 [Rhincodon typus] ref|XP_020484967.1| histone H3.3 [Labrus bergylta] ref|XP_020493283.1| histone H3.3 [Labrus bergylta] ref|XP_020493285.1| histone H3.3 [Labrus bergylta] ref|XP_020495792.1| histone H3.3 [Labrus bergylta] ref|XP_020442093.1| histone H3.3 [Monopterus albus] ref|XP_020442107.1| histone H3.3 [Monopterus albus] ref|XP_020462018.1| histone H3.3 [Monopterus albus] ref|XP_020469143.1| histone H3.3 [Monopterus albus] ref|XP_020642249.1| histone H3.3 [Pogona vitticeps] ref|XP_020642250.1| histone H3.3 [Pogona vitticeps] ref|XP_020642251.1| histone H3.3 [Pogona vitticeps] ref|XP_020660735.1| histone H3.3 [Pogona vitticeps] ref|XP_020660737.1| histone H3.3 [Pogona vitticeps] ref|XP_020660738.1| histone H3.3 [Pogona vitticeps] ref|XP_020771264.1| histone H3.3 [Odocoileus virginianus texanus] ref|XP_020730067.1| histone H3.3 [Odocoileus virginianus texanus] ref|XP_020790268.1| histone H3.3 [Boleophthalmus pectinirostris] ref|XP_020774912.1| histone H3.3 [Boleophthalmus pectinirostris] ref|XP_020780089.1| histone H3.3 [Boleophthalmus pectinirostris] ref|XP_020806054.1| histone H3.3 [Drosophila serrata] ref|XP_020837803.1| histone H3.3 [Phascolarctos cinereus] ref|XP_020858323.1| histone H3.3 [Phascolarctos cinereus] ref|XP_021000498.1| histone H3.3 [Parasteatoda tepidariorum] ref|XP_021068124.1| histone H3.3 [Mus pahari] ref|XP_021028818.1| histone H3.3 [Mus caroli] ref|XP_021031763.1| histone H3.3 [Mus caroli] ref|XP_021172964.1| histone H3.3 [Fundulus heteroclitus] ref|XP_021193696.1| histone H3.3 [Helicoverpa armigera] ref|XP_021270265.1| histone H3.3 [Numida meleagris] ref|XP_021248269.1| histone H3.3 [Numida meleagris] ref|XP_021346644.1| histone H3.3 [Mizuhopecten yessoensis] ref|XP_021397342.1| histone H3.3 [Lonchura striata domestica] ref|XP_021398988.1| histone H3.3 [Lonchura striata domestica] ref|XP_021401352.1| histone H3.3 [Lonchura striata domestica] ref|XP_021473411.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021479547.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021420357.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021420842.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021420843.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021431291.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021431292.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021437834.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021437835.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021437836.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021437837.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021443319.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021443320.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021443321.1| histone H3.3 [Oncorhynchus mykiss] ref|XP_021491502.1| histone H3.3 [Meriones unguiculatus] ref|XP_021497522.1| histone H3.3 [Meriones unguiculatus] ref|XP_021511235.1| histone H3.3 [Meriones unguiculatus] ref|XP_021547325.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021547352.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021547389.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021547421.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021547466.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021547503.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_021535182.1| histone H3.3 [Neomonachus schauinslandi] ref|XP_012309119.2| histone H3.3 [Aotus nancymaae] ref|XP_003904604.2| histone H3.3 [Papio anubis] ref|XP_021920678.1| histone H3.3 [Zootermopsis nevadensis] ref|XP_021920679.1| histone H3.3 [Zootermopsis nevadensis] ref|XP_021952400.1| histone H3.3 [Folsomia candida] ref|XP_021952401.1| histone H3.3 [Folsomia candida] ref|XP_022046566.1| histone H3.3 [Acanthochromis polyacanthus] ref|XP_022057185.1| histone H3.3 [Acanthochromis polyacanthus] ref|XP_022060257.1| histone H3.3 [Acanthochromis polyacanthus] ref|XP_022117261.1| histone H3.3 [Pieris rapae] ref|XP_022117262.1| histone H3.3 [Pieris rapae] ref|XP_022170416.1| histone H3.3 [Myzus persicae] ref|XP_022170418.1| histone H3.3 [Myzus persicae] ref|XP_022173625.1| histone H3.3 [Myzus persicae] ref|XP_022194138.1| histone H3.3 [Nilaparvata lugens] ref|XP_022234232.1| histone H3.3 [Drosophila obscura] ref|XP_022232633.1| histone H3.3 [Drosophila obscura] ref|XP_022242951.1| histone H3.3 [Limulus polyphemus] ref|XP_022242952.1| histone H3.3 [Limulus polyphemus] ref|XP_022242954.1| histone H3.3 [Limulus polyphemus] ref|XP_022243495.1| histone H3.3 [Limulus polyphemus] ref|XP_022243496.1| histone H3.3 [Limulus polyphemus] ref|XP_022244631.1| histone H3.3 [Limulus polyphemus] ref|XP_022249978.1| histone H3.3 [Limulus polyphemus] ref|XP_022314688.1| histone H3.3 [Crassostrea virginica] ref|XP_022323878.1| histone H3.3 [Crassostrea virginica] ref|XP_022323879.1| histone H3.3 [Crassostrea virginica] ref|XP_022363862.1| histone H3.3 isoform X1 [Enhydra lutris kenyoni] ref|XP_022378963.1| histone H3.3 [Enhydra lutris kenyoni] ref|XP_022435053.1| histone H3.3 [Delphinapterus leucas] ref|XP_022445293.1| histone H3.3 [Delphinapterus leucas] ref|XP_022522671.1| histone H3.3 [Astyanax mexicanus] ref|XP_022598253.1| histone H3.3 [Seriola dumerili] ref|XP_022599220.1| histone H3.3 [Seriola dumerili] ref|XP_022601833.1| histone H3.3 [Seriola dumerili] ref|XP_022616265.1| histone H3.3 [Seriola dumerili] ref|XP_022616266.1| histone H3.3 [Seriola dumerili] ref|XP_022651186.1| histone H3.3 [Varroa destructor] ref|XP_022651187.1| histone H3.3 [Varroa destructor] ref|XP_022651188.1| histone H3.3 [Varroa destructor] ref|XP_022665005.1| histone H3.3 [Varroa destructor] ref|XP_022698414.1| histone H3.3 [Varroa jacobsoni] ref|XP_022698415.1| histone H3.3 [Varroa jacobsoni] ref|XP_022698416.1| histone H3.3 [Varroa jacobsoni] ref|XP_022705209.1| histone H3.3 [Varroa jacobsoni] ref|XP_022831212.1| histone H3.3 [Spodoptera litura] ref|XP_022916787.1| histone H3.3 [Onthophagus taurus] ref|XP_023020109.1| histone H3.3 [Leptinotarsa decemlineata] ref|XP_023059399.1| histone H3.3 [Piliocolobus tephrosceles] ref|XP_023067564.1| histone H3.3 [Piliocolobus tephrosceles] ref|XP_023070713.1| histone H3.3 [Piliocolobus tephrosceles] ref|XP_023103082.1| histone H3.3 [Felis catus] ref|XP_023122169.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023122170.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023122171.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023122172.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023129132.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023129151.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023143492.1| histone H3.3 [Amphiprion ocellaris] ref|XP_023170789.1| histone H3.3 [Drosophila hydei] ref|XP_023171925.1| histone H3.3 [Drosophila hydei] ref|XP_023171926.1| histone H3.3 [Drosophila hydei] ref|XP_023237404.1| histone H3.3 [Centruroides sculpturatus] ref|XP_023237405.1| histone H3.3 [Centruroides sculpturatus] ref|XP_023237406.1| histone H3.3 [Centruroides sculpturatus] ref|XP_023212098.1| histone H3.3 [Centruroides sculpturatus] ref|XP_023260943.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023260945.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023260946.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023267002.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023273504.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023278444.1| histone H3.3 [Seriola lalandi dorsalis] ref|XP_023294690.1| histone H3.3 [Lucilia cuprina] ref|XP_023317899.1| histone H3.3 [Trichogramma pretiosum] ref|XP_023317900.1| histone H3.3 [Trichogramma pretiosum] ref|XP_023317901.1| histone H3.3 [Trichogramma pretiosum] ref|XP_023317903.1| histone H3.3 [Trichogramma pretiosum] ref|XP_023336621.1| histone H3.3 [Eurytemora affinis] ref|XP_023338246.1| histone H3.3 [Eurytemora affinis] ref|XP_023358266.1| histone H3.3 [Sarcophilus harrisii] ref|XP_023420679.1| histone H3.3 [Cavia porcellus] ref|XP_023488581.1| histone H3.3 [Equus caballus] ref|XP_023499762.1| histone H3.3 [Equus caballus] ref|XP_023556947.1| histone H3.3 [Octodon degus] ref|XP_023672337.1| histone H3.3 [Paramormyrops kingsleyae] ref|XP_023689193.1| histone H3.3 [Paramormyrops kingsleyae] ref|XP_023692664.1| histone H3.3 [Paramormyrops kingsleyae] ref|XP_023692729.1| histone H3.3 [Paramormyrops kingsleyae] ref|XP_023663856.1| histone H3.3 [Paramormyrops kingsleyae] ref|XP_023723697.1| histone H3.3 [Cryptotermes secundus] ref|XP_023794367.1| histone H3.3 [Cyanistes caeruleus] ref|XP_023837913.1| histone H3.3 [Salvelinus alpinus] ref|XP_023837921.1| histone H3.3 [Salvelinus alpinus] ref|XP_023837933.1| histone H3.3 [Salvelinus alpinus] ref|XP_023837943.1| histone H3.3 [Salvelinus alpinus] ref|XP_023837949.1| histone H3.3 [Salvelinus alpinus] ref|XP_023839181.1| histone H3.3 [Salvelinus alpinus] ref|XP_023849028.1| histone H3.3 [Salvelinus alpinus] ref|XP_023867733.1| histone H3.3 [Salvelinus alpinus] ref|XP_023822165.1| histone H3.3 [Salvelinus alpinus] ref|XP_023822166.1| histone H3.3 [Salvelinus alpinus] ref|XP_023822167.1| histone H3.3 [Salvelinus alpinus] ref|XP_023823848.1| histone H3.3 [Salvelinus alpinus] ref|XP_023817989.1| histone H3.3 [Oryzias latipes] ref|XP_023952756.1| histone H3.3 [Bicyclus anynana] ref|XP_023952757.1| histone H3.3 [Bicyclus anynana] ref|XP_023967414.1| histone H3.3 [Chrysemys picta bellii] ref|XP_024069868.1| histone H3.3 [Terrapene mexicana triunguis] ref|XP_024070321.1| histone H3.3 [Terrapene mexicana triunguis] ref|XP_024140829.1| histone H3.3-like [Oryzias melastigma] ref|XP_024119599.1| histone H3.3-like [Oryzias melastigma] ref|XP_024120240.1| histone H3.3 [Oryzias melastigma] ref|XP_024225371.1| histone H3.3 [Bombus impatiens] ref|XP_024225373.1| histone H3.3 [Bombus impatiens] ref|XP_024257199.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024257200.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024261982.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024287860.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024288127.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024298189.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024298190.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024300515.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024300516.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024300517.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024236625.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024242606.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024242607.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024243202.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024243617.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024243618.1| histone H3.3 [Oncorhynchus tshawytscha] ref|XP_024249477.1| histone H3.3 [Oncorhynchus tshawytscha] sp|P84245.2|H33_RAT RecName: Full=Histone H3.3 sp|P84243.2|H33_HUMAN RecName: Full=Histone H3.3 sp|P84244.2|H33_MOUSE RecName: Full=Histone H3.3 sp|P84246.2|H33_RABIT RecName: Full=Histone H3.3 sp|P84247.2|H33_CHICK RecName: Full=Histone H3.3; AltName: Full=H3.3A/B; AltName: Full=Histone H3 class II sp|P84248.2|H33_SPISO RecName: Full=Histone H3.3 sp|P84250.2|H33_DROHY RecName: Full=Histone H3.3; AltName: Full=H3.A/B sp|Q71LE2.3|H33_PIG RecName: Full=Histone H3.3 sp|Q5E9F8.3|H33_BOVIN RecName: Full=Histone H3.3 sp|Q6P823.3|H33_XENTR RecName: Full=Histone H3.3 sp|Q6PI20.3|H33_DANRE RecName: Full=Histone H3.3 sp|Q6PI79.3|H33_XENLA RecName: Full=Histone H3.3 sp|C0HL66.1|H33A_DROME RecName: Full=Histone H3.3A; AltName: Full=H3.A sp|C0HL67.1|H33B_DROME RecName: Full=Histone H3.3B; AltName: Full=H3.B pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-h4 Heterodimer In Complex With Its Chaperone Daxx gb|AAG17271.1|AF218029_1 unknown [Homo sapiens] gb|AAL76273.1|AF469469_1 histone H3.3A [Sus scrofa] emb|CAA36179.1| unnamed protein product [Oryctolagus cuniculus] emb|CAA37819.1| Histone H3.3Q [Drosophila melanogaster] emb|CAA31940.1| unnamed protein product [Mus musculus] emb|CAA68458.1| unnamed protein product [Gallus gallus] gb|AAA29965.1| histone H3 [Spisula solidissima] gb|AAA48794.1| histone 3.3 [Gallus gallus] gb|AAA52653.1| H3.3 histone [Homo sapiens] gb|AAA52654.1| H3.3 histone [Homo sapiens] emb|CAA52035.1| histon H3 [Rattus norvegicus] emb|CAA88778.1| histone H3.3 [Homo sapiens] emb|CAA57078.1| histone H3.3 [Drosophila hydei] emb|CAA57081.1| histone H3.3 [Drosophila hydei] emb|CAA57080.1| histone H3.3 [Drosophila melanogaster] emb|CAA57077.1| histone H3.3 [Drosophila melanogaster] emb|CAA57712.1| histone H3.3A variant [Drosophila melanogaster] emb|CAB06625.1| histone H3.3A [Mus musculus] gb|AAF46452.1| histone H3.3B, isoform A [Drosophila melanogaster] gb|AAF52213.1| histone H3.3A, isoform A [Drosophila melanogaster] gb|AAH01124.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH02268.1| H3 histone, family 3A [Mus musculus] dbj|BAB22464.1| unnamed protein product [Mus musculus] gb|AAH06497.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH12687.1| H3 histone, family 3A [Mus musculus] gb|AAH12813.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAK61362.1| histone 3A [Anopheles gambiae] gb|AAH17558.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAL48679.1| RE14004p [Drosophila melanogaster] gb|AAH29405.1| H3 histone, family 3A [Homo sapiens] gb|AAM48354.1| LD17717p [Drosophila melanogaster] gb|AAM50283.1| RE21618p [Drosophila melanogaster] gb|AAN09245.1| histone H3.3B, isoform B [Drosophila melanogaster] gb|AAH37730.1| H3 histone, family 3B [Mus musculus] gb|AAH38989.1| H3 histone, family 3A [Homo sapiens] dbj|BAC29895.1| unnamed protein product [Mus musculus] dbj|BAC40130.1| unnamed protein product [Mus musculus] gb|AAH41218.1| MGC52708 protein [Xenopus laevis] gb|AAH42290.1| H3f3b-prov protein [Xenopus laevis] gb|AAH42309.1| H3f3a-prov protein [Xenopus laevis] gb|AAO41645.1| histone H3.3B, isoform C [Drosophila melanogaster] gb|AAH49017.1| Zgc:56418 [Danio rerio] gb|EAA01174.2| AGAP001813-PA [Anopheles gambiae str. PEST] emb|CAD97621.1| hypothetical protein [Homo sapiens] gb|AAH57444.1| H3 histone, family 3C [Danio rerio] gb|AAR09797.1| similar to Drosophila melanogaster His3.3A, partial [Drosophila yakuba] gb|AAH61408.1| H3 histone, family 3B (H3.3B) [Xenopus tropicalis] gb|AAH63159.1| H3 histone, family 3B [Rattus norvegicus] emb|CAG02570.1| unnamed protein product, partial [Tetraodon nigroviridis] emb|CAG02722.1| unnamed protein product [Tetraodon nigroviridis] emb|CAG06431.1| unnamed protein product [Tetraodon nigroviridis] gb|AAH70966.1| MGC78769 protein [Xenopus laevis] emb|CAF25046.1| histone H3.3 [Oikopleura dioica] gb|AAH71406.1| H3 histone, family 3A [Danio rerio] gb|AAH74158.1| MGC81913 protein [Xenopus laevis] gb|AAH77035.1| MGC89877 protein [Xenopus tropicalis] gb|AAH78759.1| H3 histone, family 3B [Rattus norvegicus] gb|AAU09479.1| GekBS038P [Gekko japonicus] gb|AAH81560.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|AAH83353.1| H3 histone, family 3A [Mus musculus] gb|EAL33023.1| uncharacterized protein Dpse_GA19158 [Drosophila pseudoobscura pseudoobscura] gb|AAH86580.1| H3f3b protein [Rattus norvegicus] gb|AAH87725.1| H3f3b protein [Rattus norvegicus] gb|AAH88835.1| H3 histone, family 3A [Mus musculus] gb|AAX08979.1| H3 histone, family 3A [Bos taurus] gb|AAX19363.1| replacement histone H3.3 [Ruditapes philippinarum] gb|AAH92043.1| H3 histone, family 3B [Mus musculus] gb|AAH92854.1| Zgc:110292 [Danio rerio] gb|AAH95447.1| H3 histone, family 3A [Homo sapiens] gb|AAI03072.1| H3F3A protein [Bos taurus] dbj|BAE40831.1| unnamed protein product [Mus musculus] dbj|BAE31831.1| unnamed protein product [Mus musculus] dbj|BAE35953.1| unnamed protein product [Mus musculus] dbj|BAE40995.1| unnamed protein product [Mus musculus] dbj|BAE31877.1| unnamed protein product [Mus musculus] dbj|BAE31939.1| unnamed protein product [Mus musculus] dbj|BAE29685.1| unnamed protein product [Mus musculus] dbj|BAE32069.1| unnamed protein product [Mus musculus] dbj|BAE36524.1| unnamed protein product [Mus musculus] dbj|BAE29966.1| unnamed protein product [Mus musculus] dbj|BAE36694.1| unnamed protein product [Mus musculus] dbj|BAE22687.1| unnamed protein product [Mus musculus] dbj|BAE37253.1| unnamed protein product [Mus musculus] dbj|BAE30261.1| unnamed protein product [Mus musculus] dbj|BAE30314.1| unnamed protein product [Mus musculus] dbj|BAE30566.1| unnamed protein product [Mus musculus] dbj|BAE30586.1| unnamed protein product [Mus musculus] dbj|BAE30589.1| unnamed protein product [Mus musculus] dbj|BAE35232.1| unnamed protein product [Mus musculus] dbj|BAE39850.1| unnamed protein product [Mus musculus] dbj|BAE39892.1| unnamed protein product [Mus musculus] dbj|BAE35427.1| unnamed protein product [Mus musculus] dbj|BAE30757.1| unnamed protein product [Mus musculus] dbj|BAE40157.1| unnamed protein product [Mus musculus] dbj|BAE31102.1| unnamed protein product [Mus musculus] dbj|BAE31231.1| unnamed protein product [Mus musculus] dbj|BAE31233.1| unnamed protein product [Mus musculus] dbj|BAE29584.1| unnamed protein product [Mus musculus] dbj|BAE29585.1| unnamed protein product [Mus musculus] dbj|BAE40542.1| unnamed protein product [Mus musculus] dbj|BAE31366.1| unnamed protein product [Mus musculus] dbj|BAE31590.1| unnamed protein product [Mus musculus] dbj|BAE31666.1| unnamed protein product [Mus musculus] gb|AAI06303.1| MGC52708 protein [Xenopus laevis] gb|AAI06178.1| H3 histone, family 3A [Mus musculus] gb|AAI08702.1| H3 histone, family 3B (H3.3B) [Homo sapiens] gb|ABD36130.1| h3 histone family 3a [Bombyx mori] gb|ABD98756.1| putative H3 histone, family 3A [Graphocephala atropunctata] gb|ABF57428.1| H3 histone, family 3B [Bos taurus] gb|EAT42283.1| AAEL006158-PA [Aedes aegypti] gb|ABG43104.1| histone H3 [Pectinaria gouldii] emb|CAL49400.1| H3 histone [Xenopus tropicalis] gb|AAI23121.1| MGC52708 protein [Xenopus laevis] emb|CAL38070.1| hypothetical protein, partial [synthetic construct] gb|EAW69770.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69771.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69772.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW69773.1| H3 histone, family 3A, isoform CRA_a [Homo sapiens] gb|EAW89317.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|EAW89318.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|EAW89319.1| H3 histone, family 3B (H3.3B), isoform CRA_a [Homo sapiens] gb|ABM55584.1| putative histone H3 [Maconellicoccus hirsutus] gb|ABM55592.1| putative H3 histone, family 3B [Maconellicoccus hirsutus] gb|ABM83541.1| H3 histone, family 3A [synthetic construct] gb|ABM86781.1| H3 histone, family 3A, partial [synthetic construct] emb|CAK32534.1| histone H3.3 [Oikopleura dioica] gb|AAI34735.1| H3 histone, family 3A [Bos taurus] dbj|BAF62355.1| H3 histone, family 3A [Pan troglodytes verus] gb|EDL13145.1| mCG19829 [Mus musculus] gb|EDL34545.1| mCG6618 [Mus musculus] gb|EDL94833.1| rCG20294, isoform CRA_a [Rattus norvegicus] gb|EDM06637.1| H3 histone, family 3B, isoform CRA_a [Rattus norvegicus] gb|ABR22618.1| histone 3 [Aplysia californica] gb|ABR27830.1| H3 histone family 3B [Triatoma infestans] gb|AAI52135.1| Zgc:64222 protein [Danio rerio] gb|AAI54270.1| Zgc:56418 protein [Danio rerio] gb|ABX89280.1| histone cluster 1, H3a (predicted) [Papio anubis] gb|AAI57317.1| MGC89877 protein [Xenopus tropicalis] gb|AAI57315.1| h3f3b protein [Xenopus tropicalis] gb|AAI58616.1| H3f3b protein [Rattus norvegicus] gb|AAI59440.1| H3f3b protein [Rattus norvegicus] gb|ABZ92486.1| H3 histone, family 3B (H3.3B), partial [synthetic construct] gb|EDS44786.1| histone H3.3 type 2 [Culex quinquefasciatus] gb|AAI65500.1| H3f3c protein [Danio rerio] dbj|BAG34846.1| unnamed protein product [Homo sapiens] gb|EDV32216.1| uncharacterized protein Dana_GF15720 [Drosophila ananassae] gb|EDV33762.1| uncharacterized protein Dana_GF19171 [Drosophila ananassae] gb|EDV46293.1| uncharacterized protein Dere_GG19000 [Drosophila erecta] gb|EDV57824.1| uncharacterized protein Dere_GG25048 [Drosophila erecta] gb|EDV92098.1| GH24723 [Drosophila grimshawi] gb|EDW03888.1| GH11489 [Drosophila grimshawi] gb|EDW07414.1| uncharacterized protein Dmoj_GI14879 [Drosophila mojavensis] gb|EDW11127.1| uncharacterized protein Dmoj_GI16984 [Drosophila mojavensis] gb|EDW25354.1| GL26550 [Drosophila persimilis] gb|EDW30520.1| GL26831 [Drosophila persimilis] gb|EDW51275.1| GM13676 [Drosophila sechellia] gb|EDW54332.1| GM18523 [Drosophila sechellia] gb|EDW58018.1| uncharacterized protein Dvir_GJ15308 [Drosophila virilis] gb|EDW64014.1| uncharacterized protein Dvir_GJ17231 [Drosophila virilis] gb|EDW75486.1| uncharacterized protein Dwil_GK23881 [Drosophila willistoni] gb|EDW82368.1| uncharacterized protein Dwil_GK25162, isoform A [Drosophila willistoni] gb|EDW88387.1| His3.3A [Drosophila yakuba] gb|EDX02176.1| uncharacterized protein Dyak_GE17412 [Drosophila yakuba] gb|EDX03788.1| GD23319 [Drosophila simulans] gb|ACH44318.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH44319.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH46260.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46261.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46263.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46264.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46265.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46266.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46267.1| putative H3 histone family 3B variant 2 [Taeniopygia guttata] gb|ACH46268.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46269.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46270.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46338.1| putative H3 histone family 3B variant 1 [Taeniopygia guttata] gb|ACH46375.1| putative H3 histone family 3A [Taeniopygia guttata] gb|ACH70745.1| H3 histone family 3A [Salmo salar] gb|EDY72858.1| uncharacterized protein Dpse_GA22698 [Drosophila pseudoobscura pseudoobscura] dbj|BAG73253.1| Histone H3.3, partial [synthetic construct] gb|ACI33069.1| Histone H3.3 [Salmo salar] gb|ACI33957.1| Histone H3.3 [Salmo salar] gb|ACI34226.1| Histone H3.3 [Salmo salar] gb|ACI67089.1| Histone H3.3 [Salmo salar] gb|ACI67783.1| Histone H3.3 [Salmo salar] gb|ACI68375.1| Histone H3.3 [Salmo salar] gb|ACI69310.1| Histone H3.3 [Salmo salar] gb|ACI70069.1| Histone H3.3 [Salmo salar] gb|EEB17922.1| histone H3.3 [Pediculus humanus corporis] gb|EEC02656.1| Core histone H2A/H2B/H3/H4 [Ixodes scapularis] gb|ACL87760.1| His3.3A-PA, partial [synthetic construct] gb|ACL92191.1| His3.3A-PA [synthetic construct] gb|ACL92440.1| His3.3A-PA [synthetic construct] gb|ACM08300.1| Histone H3.3 [Salmo salar] gb|ACM08661.1| Histone H3.3 [Salmo salar] gb|ACM08967.1| Histone H3.3 [Salmo salar] gb|ACM09352.1| Histone H3.3 [Salmo salar] gb|ACM09780.1| Histone H3.3 [Salmo salar] gb|ACN10203.1| Histone H3.3 [Salmo salar] gb|ACN10246.1| Histone H3.3 [Salmo salar] gb|ACN12557.1| Histone H3.3 [Salmo salar] gb|ACN12601.1| Histone H3.3 [Salmo salar] gb|ACO07595.1| Histone H3.3 [Oncorhynchus mykiss] gb|ACO09276.1| Histone H3.3 [Osmerus mordax] gb|ACO09281.1| Histone H3.3 [Osmerus mordax] gb|ACO12781.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ACO12834.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ACO14940.1| Histone H3.3 [Caligus clemensi] gb|ACO15238.1| Histone H3.3 [Caligus clemensi] gb|ACO15474.1| Histone H3.3 [Caligus clemensi] gb|EEN45251.1| hypothetical protein BRAFLDRAFT_120760 [Branchiostoma floridae] gb|EEN51635.1| hypothetical protein BRAFLDRAFT_117519 [Branchiostoma floridae] gb|ACQ58573.1| Histone H3.3 [Anoplopoma fimbria] emb|CBH09251.1| putative Histone H3 [Heliconius melpomene] dbj|BAI46602.1| H3 histone, family 3A, partial [synthetic construct] gb|EFA07829.1| Histone H3.3-like Protein [Tribolium castaneum] gb|EFB25626.1| hypothetical protein PANDA_008580, partial [Ailuropoda melanoleuca] gb|EFB29651.1| hypothetical protein PANDA_016437, partial [Ailuropoda melanoleuca] emb|CAP53904.1| histone H3.3 [Xenoturbella bocki] emb|CAP57915.1| histone H3.3 [Xenoturbella bocki] gb|ADD38620.1| Histone H3.3 [Lepeophtheirus salmonis] gb|ADD38769.1| Histone H3.3 [Lepeophtheirus salmonis] dbj|BAI83414.1| histone H3 [Parasteatoda tepidariorum] tpg|DAA18137.1| TPA: histone H3.3B-like [Bos taurus] tpg|DAA21369.1| TPA: histone H3.3 [Bos taurus] gb|ADM15975.1| Histone H3.3 [Salmo salar] gb|ADM16206.1| Histone H3.3 [Salmo salar] gb|EFN62078.1| Histone H3.3 [Camponotus floridanus] gb|EFN83154.1| Histone H3.3 [Harpegnathos saltator] gb|EFO14545.1| histone H3 [Loa loa] gb|EFO23321.1| H3 histone, family 3A [Loa loa] gb|ADO27848.1| histone h3.3 [Ictalurus furcatus] gb|ADO28924.1| histone h3.3 [Ictalurus punctatus] emb|CBY30878.1| unnamed protein product [Oikopleura dioica] emb|CBY10218.1| unnamed protein product [Oikopleura dioica] emb|CBY25129.1| unnamed protein product [Oikopleura dioica] emb|CBN81162.1| Histone H3 [Dicentrarchus labrax] emb|CBN81301.1| Uncharacterized protein [Dicentrarchus labrax] gb|EFX74442.1| hypothetical protein DAPPUDRAFT_231307 [Daphnia pulex] tpg|DAA34575.1| TPA_exp: H3 histone family 3A [Amblyomma variegatum] gb|EGI68969.1| Histone H3.3 [Acromyrmex echinatior] gb|EGI68970.1| Histone H3.3 [Acromyrmex echinatior] gb|AEE62718.1| unknown [Dendroctonus ponderosae] gb|EGK97461.1| AGAP001813-PB [Anopheles gambiae str. PEST] emb|CBM82511.1| histone H3.3 protein [Balanoglossus clavigerus] gb|AEM37650.1| histone H3, partial [Epinephelus bruneus] dbj|BAK63626.1| histone H3.3 [Pan troglodytes] gb|EHB06352.1| Histone H3.3 [Heterocephalus glaber] gb|EHB10765.1| Histone H3.3 [Heterocephalus glaber] gb|EHH15496.1| hypothetical protein EGK_01597 [Macaca mulatta] gb|EHH25207.1| hypothetical protein EGK_08989 [Macaca mulatta] gb|EHH50500.1| hypothetical protein EGM_01343 [Macaca fascicularis] gb|EHH61688.1| hypothetical protein EGM_19729 [Macaca fascicularis] dbj|BAM18163.1| histone H3.3B [Papilio xuthus] dbj|BAM19145.1| histone H3.3B [Papilio polytes] gb|AFM89658.1| histone H33 [Callorhinchus milii] gb|EJW82753.1| histone H3 [Wuchereria bancrofti] gb|EJW87260.1| histone H3 [Wuchereria bancrofti] gb|EKC17910.1| Histone H3.3 [Crassostrea gigas] gb|ELK12359.1| Histone H3.3 [Pteropus alecto] gb|AGB92618.1| histone H3.3A, isoform C [Drosophila melanogaster] gb|AAN10526.2| histone H3.3A, isoform D [Drosophila melanogaster] gb|AGB95217.1| histone H3.3B, isoform E [Drosophila melanogaster] gb|ELR48666.1| hypothetical protein M91_05641 [Bos mutus] gb|ELR49990.1| Histone H3.3 [Bos mutus] gb|AGC92675.1| Histone H3.3-like protein [Heliconius erato] gb|ELT93764.1| hypothetical protein CAPTEDRAFT_152257 [Capitella teleta] gb|ELW68308.1| Histone H3.3 [Tupaia chinensis] emb|CCQ18650.1| histone H3 [Sycon ciliatum] gb|AGG41269.1| histone H3.3 [Cerebratulus lacteus] gb|EMP28698.1| Histone H3.3 [Chelonia mydas] gb|AGH92507.1| histone H3.3 [Salmo salar] gb|ENN76942.1| hypothetical protein YQE_06588, partial [Dendroctonus ponderosae] gb|EOB08186.1| Histone H3.3, partial [Anas platyrhynchos] dbj|BAN20326.1| histone H3.3 [Riptortus pedestris] gb|EPB71174.1| core histone H2A/H2B/H3/H4 [Ancylostoma ceylanicum] gb|AGT29358.1| histone H3 [Artemia parthenogenetica] gb|EQB77250.1| histone H3.3-like protein [Camelus ferus] gb|EQB78545.1| histone H3.3-like protein [Camelus ferus] gb|ERE72950.1| Histone H3 containing protein [Cricetulus griseus] gb|ERL89712.1| hypothetical protein D910_07074 [Dendroctonus ponderosae] gb|ESO07202.1| hypothetical protein HELRODRAFT_185455 [Helobdella robusta] gb|ESO84775.1| hypothetical protein LOTGIDRAFT_150994 [Lottia gigantea] emb|CDJ97587.1| Histone core domain containing protein [Haemonchus contortus] gb|ETN62190.1| histone H3.3 [Anopheles darlingi] gb|ETN74986.1| core histone H2A/H2B/H3/H4 [Necator americanus] gb|ETN79664.1| core histone H2A/H2B/H3/H4 [Necator americanus] gb|EYB84770.1| hypothetical protein Y032_0310g2098 [Ancylostoma ceylanicum] gb|EYB89660.1| hypothetical protein Y032_0229g2919 [Ancylostoma ceylanicum] gb|EZA49573.1| Histone H3.3 [Ooceraea biroi] gb|EZA49574.1| Histone H3.3 [Ooceraea biroi] emb|CDQ91388.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ86418.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ77348.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ77349.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ77265.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ72046.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ70414.1| unnamed protein product [Oncorhynchus mykiss] emb|CDQ70415.1| unnamed protein product [Oncorhynchus mykiss] gb|KDR19059.1| Histone H3.3 [Zootermopsis nevadensis] gb|AIC48912.1| H3F3B, partial [synthetic construct] dbj|BAP18978.1| histone H3, partial [Cynops pyrrhogaster] gb|AII16469.1| histone H3.3, partial [Paracyclopina nana] emb|CDQ00717.1| Bm4100 [Brugia malayi] gb|KFM81878.1| Histone H3.3, partial [Stegodyphus mimosarum] gb|KFO35619.1| Histone H3.3 [Fukomys damarensis] gb|KFO70471.1| Histone H3.3 [Cuculus canorus] gb|KFP15075.1| Histone H3.3 [Egretta garzetta] gb|KFQ71006.1| Histone H3.3 [Phaethon lepturus] gb|KFQ92670.1| Histone H3.3 [Nipponia nippon] gb|KFU93384.1| Histone H3.3 [Chaetura pelagica] gb|AIS25384.1| histone H3.3 [Mytilus edulis] gb|AIS25386.1| histone H3.3 [Mytilus edulis] gb|AIS25389.1| histone H3.3 [Mytilus galloprovincialis] gb|AIS25390.1| histone H3.3 [Mytilus galloprovincialis] gb|AIS25391.1| histone H3.3 [Mytilus edulis] gb|AIS25393.1| histone H3.3 [Mytilus edulis] gb|KGL80522.1| Histone H3.3 [Tinamus guttatus] gb|KHJ99858.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum] gb|KHN88012.1| Histone H3.3 [Toxocara canis] gb|KHN88013.1| Histone H3.3 [Toxocara canis] gb|KHN88014.1| Histone H3.3 [Toxocara canis] gb|KIH54469.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale] gb|KIH59959.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale] gb|KJH46555.1| core histone H2A/H2B/H3/H4 [Dictyocaulus viviparus] gb|KKF17690.1| Histone H3.3 [Larimichthys crocea] gb|KKF19998.1| Histone H3.3 [Larimichthys crocea] gb|KKF19999.1| Histone H3.3 [Larimichthys crocea] gb|KKF25738.1| Histone H3.3 [Larimichthys crocea] gb|KMQ93572.1| histone [Lasius niger] gb|KMY88233.1| uncharacterized protein Dsimw501_GD23319 [Drosophila simulans] gb|KMZ08915.1| uncharacterized protein Dsimw501_GD27984 [Drosophila simulans] gb|KNC22383.1| hypothetical protein FF38_08806 [Lucilia cuprina] gb|KOC69410.1| Histone H3.3 [Habropoda laboriosa] gb|KOF66989.1| hypothetical protein OCBIM_22010770mg [Octopus bimaculoides] gb|KOF87900.1| hypothetical protein OCBIM_22015953mg [Octopus bimaculoides] gb|ALC38241.1| His3:CG33860 [Drosophila busckii] gb|KOX81284.1| Histone H3.3 [Melipona quadrifasciata] gb|KPJ02600.1| Histone H3.3 [Papilio xuthus] gb|ALI58374.1| histone H3.3 [Cerebratulus lacteus] gb|KQK73395.1| histone H3.3 [Amazona aestiva] gb|KQK75452.1| histone H3.3 [Amazona aestiva] gb|KRF99603.1| uncharacterized protein Dwil_GK25162, isoform B [Drosophila willistoni] gb|ALS04684.1| histone H3.3 isoform 1 [Pseudodiaptomus poplesia] gb|KTF83454.1| hypothetical protein cypCar_00049288 [Cyprinus carpio] gb|KTG07174.1| hypothetical protein cypCar_00030237 [Cyprinus carpio] gb|KXJ78956.1| hypothetical protein RP20_CCG002947 [Aedes albopictus] gb|AMP19762.1| histone H3.3B isoform A [Helicoverpa armigera] gb|KYM92284.1| Histone H3.3 [Atta colombica] gb|KYM92285.1| Histone H3.3 [Atta colombica] gb|KYN00178.1| Histone H3.3 [Cyphomyrmex costatus] gb|KYN00181.1| Histone H3.3 [Cyphomyrmex costatus] gb|KYN13562.1| Histone H3.3 [Trachymyrmex cornetzi] gb|KYN13563.1| Histone H3.3 [Trachymyrmex cornetzi] gb|KYN36182.1| Histone H3.3 [Trachymyrmex septentrionalis] gb|KYN36184.1| Histone H3.3 [Trachymyrmex septentrionalis] gb|KYO43510.1| histone H3.3 [Alligator mississippiensis] gb|KYQ59695.1| Histone H3.3 [Trachymyrmex zeteki] gb|KYQ59698.1| Histone H3.3 [Trachymyrmex zeteki] gb|KZC11801.1| Histone H3.3 [Dufourea novaeangliae] gb|KZC11802.1| Histone H3.3 [Dufourea novaeangliae] gb|OAD54961.1| Histone H3.3 [Eufriesea mexicana] gb|OAD54962.1| Histone H3.3 [Eufriesea mexicana] gb|OBS60180.1| hypothetical protein A6R68_08708 [Neotoma lepida] gb|OCA21350.1| hypothetical protein XENTR_v90025560mg [Xenopus tropicalis] gb|OCA22690.1| hypothetical protein XENTR_v90023524mg [Xenopus tropicalis] gb|ANY27147.1| GEO09982p1, partial [Drosophila melanogaster] gb|ANY27398.1| GEO09217p1, partial [Drosophila melanogaster] gb|OCT60692.1| hypothetical protein XELAEV_18046713mg [Xenopus laevis] gb|OCT61548.1| hypothetical protein XELAEV_18047575mg [Xenopus laevis] gb|OCT62978.1| hypothetical protein XELAEV_18044072mg [Xenopus laevis] gb|OCT77542.1| hypothetical protein XELAEV_18028634mg [Xenopus laevis] gb|OCT79481.1| hypothetical protein XELAEV_18026291mg [Xenopus laevis] gb|ODN01741.1| histone H3.3 [Orchesella cincta] gb|AOR07126.1| histone H3 [Enchytraeus albidus] gb|AOR07127.1| histone H3 [Enchytraeus cf. crypticus SL-2017] gb|AOR07128.1| histone H3 [Mesenchytraeus cf. pedatus SL-2017] gb|AOR07129.1| histone H3 [Mesenchytraeus solifugus] gb|AOR07130.1| histone H3 [Mesenchytraeus antaeus] gb|AOR07131.1| histone H3 [Mesenchytraeus cf. gelidus SL-2017] gb|AOR07132.1| histone H3 [Mesenchytraeus hydrius] gb|AOX15712.1| histone H3 [Haliotis diversicolor] dbj|GAV07599.1| hypothetical protein RvY_17416 [Ramazzottius varieornatus] gb|APY18894.1| histone [Ruditapes philippinarum] emb|SJX26618.1| unnamed protein product, partial [Human ORFeome Gateway entry vector] gb|AQS22606.1| histone H3.3 [Pseudodiaptomus poplesia] gb|OPJ72209.1| histone H3.3-like [Patagioenas fasciata monilis] gb|OQR67088.1| histone H3.3-like [Tropilaelaps mercedesae] gb|OQR68161.1| histone H3.3-like [Tropilaelaps mercedesae] gb|OQV18469.1| histone H3.3 [Hypsibius dujardini] gb|ARK19837.1| histone H3.3 [Ampulex compressa] gb|OWF53729.1| histone H3.3 [Mizuhopecten yessoensis] gb|OWK51042.1| histone H3.3 [Lonchura striata domestica] gb|OWK51667.1| histone H3.3 [Lonchura striata domestica] gb|OWK52131.1| histone H3.3 [Lonchura striata domestica] gb|OWR53554.1| histone H3.3 [Danaus plexippus plexippus] gb|OXB68330.1| hypothetical protein ASZ78_015270 [Callipepla squamata] gb|OXB75268.1| hypothetical protein H355_000820 [Colinus virginianus] gb|OXU24037.1| hypothetical protein TSAR_014254 [Trichomalopsis sarcophagae] gb|OZC09228.1| core histone H2A/H2B/H3/H4 [Onchocerca flexuosa] gb|OZC09518.1| core histone H2A/H2B/H3/H4 [Onchocerca flexuosa] gb|PAV81340.1| hypothetical protein WR25_09325 [Diploscapter pachys] gb|PAV84297.1| hypothetical protein WR25_16872 [Diploscapter pachys] gb|ASY01578.1| histone variant H3.3 [Mimachlamys varia] gb|PBC28733.1| Histone H3.3 [Apis cerana cerana] gb|PCG72184.1| hypothetical protein B5V51_1079 [Heliothis virescens] gb|ATO94475.1| hypothetical protein, partial [synthetic construct] gb|ATO94803.1| H3 histone, family 3B (H3.3B), partial [synthetic construct] gb|PIO27368.1| Histone H3.3 [Rana catesbeiana] gb|PIO40779.1| Histone H3.3 [Rana catesbeiana] gb|PIO40780.1| Histone H3.3 [Rana catesbeiana] gb|PIO71842.1| core histone H2A/H2B/H3/H4 [Teladorsagia circumcincta] gb|PIO73535.1| core histone H2A/H2B/H3/H4 [Teladorsagia circumcincta] gb|PKU28208.1| histone [Limosa lapponica baueri] gb|PNI31654.1| H3F3A isoform 1 [Pan troglodytes] gb|PNI31655.1| H3F3A isoform 2 [Pan troglodytes] gb|PNI31657.1| H3F3A isoform 4 [Pan troglodytes] gb|PNI32228.1| H3F3B isoform 2 [Pan troglodytes] gb|PNI32229.1| H3F3B isoform 3 [Pan troglodytes] gb|PNI32230.1| H3F3B isoform 4 [Pan troglodytes] gb|PNI32235.1| H3F3B isoform 13 [Pan troglodytes] gb|PNJ39336.1| H3F3A isoform 1 [Pongo abelii] gb|PNJ39337.1| H3F3A isoform 2 [Pongo abelii] gb|PNJ39338.1| H3F3A isoform 3 [Pongo abelii] gb|PNJ39339.1| H3F3A isoform 4 [Pongo abelii] gb|PNJ87932.1| H3F3B isoform 1 [Pongo abelii] gb|PNJ87935.1| H3F3B isoform 7 [Pongo abelii] gb|PNJ87936.1| H3F3B isoform 8 [Pongo abelii] gb|PNJ87937.1| H3F3B isoform 9 [Pongo abelii] Length = 136 Score = 265 bits (676), Expect = 1e-83 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 pdb|3AV2|E Chain E, The Human Nucleosome Structure Containing The Histone Variant H3.3 pdb|5B32|A Chain A, The Crystal Structure Of The Heterotypic H2az/h2a Nucleosome With H3.3. pdb|5B32|E Chain E, The Crystal Structure Of The Heterotypic H2az/h2a Nucleosome With H3.3. pdb|5B33|A Chain A, The Crystal Structure Of The H2az Nucleosome With H3.3. pdb|5B33|E Chain E, The Crystal Structure Of The H2az Nucleosome With H3.3. pdb|5X7X|A Chain A, The Crystal Structure Of The Nucleosome Containing H3.3 At 2.18 Angstrom Resolution pdb|5X7X|E Chain E, The Crystal Structure Of The Nucleosome Containing H3.3 At 2.18 Angstrom Resolution pdb|5XM0|A Chain A, The mouse nucleosome structure containing H2A, H2B type3-A, H3.3, and H4 pdb|5XM0|E Chain E, The mouse nucleosome structure containing H2A, H2B type3-A, H3.3, and H4 Length = 139 Score = 265 bits (676), Expect = 2e-83 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 4 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 63 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 64 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 123 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 124 MPKDIQLARRIRGERA 139 >ref|XP_015819260.1| PREDICTED: histone H3.3 isoform X1 [Nothobranchius furzeri] Length = 140 Score = 265 bits (676), Expect = 2e-83 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 5 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 64 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 65 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 124 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 125 MPKDIQLARRIRGERA 140 >pdb|3WTP|E Chain E, Crystal Structure of the heterotypic nucleosome containing human CENP-A and H3.3 Length = 140 Score = 265 bits (676), Expect = 2e-83 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 5 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 64 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 65 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 124 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 125 MPKDIQLARRIRGERA 140 >gb|ACO07612.1| Histone H3.3 [Oncorhynchus mykiss] Length = 136 Score = 264 bits (675), Expect = 2e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCA+HAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAVHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|XP_009166091.1| hypothetical protein T265_13221, partial [Opisthorchis viverrini] ref|XP_012796725.1| Histone H3.3 [Schistosoma haematobium] ref|XP_018644337.1| histone H3, putative [Schistosoma mansoni] gb|AAW24748.1| SJCHGC01198 protein [Schistosoma japonicum] emb|CAX72005.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72006.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72007.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72008.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72009.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72010.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72011.1| Histone H3.3 [Schistosoma japonicum] emb|CAX72012.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78697.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78698.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78700.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78701.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78702.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78703.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78704.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78705.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78706.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78707.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78708.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78709.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78710.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78711.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78712.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78713.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78714.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78715.1| Histone H3.3 [Schistosoma japonicum] emb|CAX78716.1| Histone H3.3 [Schistosoma japonicum] emb|CAX75182.1| Histone H3.3 [Schistosoma japonicum] emb|CAX75183.1| Histone H3.3 [Schistosoma japonicum] emb|CAX75184.1| Histone H3.3 [Schistosoma japonicum] emb|CAX75185.1| Histone H3.3 [Schistosoma japonicum] emb|CAZ35552.1| histone H3, putative [Schistosoma mansoni] dbj|GAA29599.1| histone H3 [Clonorchis sinensis] gb|AFL48195.1| histone H3 [Schmidtea mediterranea] gb|EUB54600.1| Histone H3.3 [Echinococcus granulosus] gb|KER30170.1| hypothetical protein T265_13221, partial [Opisthorchis viverrini] emb|CDS18053.1| expressed protein [Echinococcus granulosus] emb|CDS25794.1| histone H3 [Hymenolepis microstoma] gb|KFM77247.1| Histone H3.3, partial [Stegodyphus mimosarum] gb|KGB36963.1| Histone H3.3 [Schistosoma haematobium] emb|CUT98752.1| expressed protein [Echinococcus multilocularis] gb|OON23760.1| core histone H2A/H2B/H3/H4 [Opisthorchis viverrini] gb|PAA53046.1| hypothetical protein BOX15_Mlig001513g5 [Macrostomum lignano] gb|PAA55972.1| hypothetical protein BOX15_Mlig001513g3 [Macrostomum lignano] gb|PAA59034.1| hypothetical protein BOX15_Mlig016529g3 [Macrostomum lignano] gb|PAA61031.1| hypothetical protein BOX15_Mlig018787g1 [Macrostomum lignano] gb|PAA70755.1| hypothetical protein BOX15_Mlig016529g1 [Macrostomum lignano] gb|PAA72044.1| hypothetical protein BOX15_Mlig001513g1 [Macrostomum lignano] gb|PAA82591.1| hypothetical protein BOX15_Mlig021242g3 [Macrostomum lignano] gb|PAA88027.1| hypothetical protein BOX15_Mlig001513g2 [Macrostomum lignano] gb|PAA90042.1| hypothetical protein BOX15_Mlig021242g2 [Macrostomum lignano] gb|PAA90091.1| hypothetical protein BOX15_Mlig021242g1 [Macrostomum lignano] gb|PIS77830.1| core histone H2A/H2B/H3/H4 [Fasciola hepatica] Length = 136 Score = 264 bits (675), Expect = 2e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >gb|PIS88409.1| core histone H2A/H2B/H3/H4 [Fasciola hepatica] Length = 150 Score = 264 bits (675), Expect = 3e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 15 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 74 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 75 LLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTI 134 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 135 MPKDIQLARRIRGERA 150 >ref|XP_019924179.1| PREDICTED: histone H3.3 [Crassostrea gigas] Length = 245 Score = 268 bits (684), Expect = 4e-83 Identities = 143/159 (89%), Positives = 146/159 (91%) Frame = -2 Query: 1529 NSGFISVYLLKFLIKVNQFDN*KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVK 1350 N+ F +L F IK+ KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVK Sbjct: 93 NAFFSFGNILLFYIKM------KMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVK 146 Query: 1349 KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAS 1170 KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAS Sbjct: 147 KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAS 206 Query: 1169 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 1053 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 207 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 245 >gb|PRD19945.1| Histone H3.3 [Nephila clavipes] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASE+YLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASESYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|NP_509344.1| Histone H3.3 type 1 [Caenorhabditis elegans] sp|Q10453.2|H331_CAEEL RecName: Full=Histone H3.3 type 1 gb|EGT45934.1| hypothetical protein CAEBREN_28893 [Caenorhabditis brenneri] emb|CCD66641.1| Histone H3.3 type 1 [Caenorhabditis elegans] gb|POM52400.1| hypothetical protein FL81_02902 [Caenorhabditis remanei] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|XP_020031675.1| histone H3.3-like [Castor canadensis] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALRE+RRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREMRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|XP_015139223.1| PREDICTED: histone H3.2 isoform X1 [Gallus gallus] ref|XP_015712714.1| PREDICTED: histone H3.3 [Coturnix japonica] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >gb|EDL18362.1| mCG6162 [Mus musculus] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQK+TE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKATE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|XP_001623766.1| predicted protein [Nematostella vectensis] ref|XP_002113772.1| replacement histone H3.3 [Trichoplax adhaerens] ref|XP_002154470.1| PREDICTED: histone H3.3 [Hydra vulgaris] ref|XP_015766372.1| PREDICTED: histone H3.3 [Acropora digitifera] ref|XP_020628875.1| histone H3.3 [Orbicella faveolata] ref|XP_020916224.1| histone H3.3 [Exaiptasia pallida] ref|XP_022795472.1| histone H3.3 [Stylophora pistillata] sp|Q8WSF1.3|H33_TRIPS RecName: Full=Histone H3.3 gb|AAL67159.1|AF323993_1 histone H3.3 [Trichinella pseudospiralis] gb|ABL14206.1| histone H3.3-like protein protein [Trichinella spiralis] gb|EDO31666.1| predicted protein [Nematostella vectensis] gb|EDV24246.1| replacement histone H3.3 [Trichoplax adhaerens] gb|AGH70131.1| histone H3 [Placozoa sp. H4] emb|CEF64449.1| Histone H3.3 [Strongyloides ratti] gb|KRX25966.1| histone H3.3 [Trichinella nelsoni] gb|KRX49230.1| histone H3.3 [Trichinella murrelli] gb|KRX68999.1| histone H3.3 [Trichinella sp. T9] gb|KRX83238.1| histone H3.3 [Trichinella sp. T6] gb|KRY01942.1| histone H3.3, partial [Trichinella pseudospiralis] gb|KRY22451.1| histone H3.3 [Trichinella patagoniensis] gb|KRY40086.1| histone H3.3 [Trichinella spiralis] gb|KRY61314.1| histone H3.3 [Trichinella britovi] gb|KRY79371.1| histone H3.3 [Trichinella pseudospiralis] gb|KRY93715.1| histone H3.3 [Trichinella pseudospiralis] gb|KRZ11972.1| histone H3.3 [Trichinella zimbabwensis] gb|KRZ34237.1| histone H3.3 [Trichinella pseudospiralis] gb|KRZ45610.1| histone H3.3 [Trichinella pseudospiralis] gb|KRZ63308.1| histone H3.3 [Trichinella nativa] gb|KRZ80847.1| histone H3.3 [Trichinella papuae] gb|KRZ98018.1| histone H3.3 [Trichinella sp. T8] gb|AOF43142.1| histone H3.3.2 [Hydractinia echinata] gb|AOF43143.1| histone H3.3.1 [Hydractinia echinata] gb|OUC45603.1| core histone H2A/H2B/H3/H4 [Trichinella nativa] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEA+EAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >ref|XP_010832083.1| PREDICTED: histone H3.3-like [Bison bison bison] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPRKQLATKAARK+APSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKTAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >gb|AIS25392.1| histone H3.3 [Mytilus galloprovincialis] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTARKSTGGKAPR+QLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRRQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >gb|AIS25385.1| histone H3.3 [Mytilus edulis] Length = 136 Score = 263 bits (673), Expect = 4e-83 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = -2 Query: 1460 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 1281 MARTKQTAR+STGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARRSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 1280 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 1101 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 1100 MPKDIQLARRIRGERA 1053 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136