BLASTX nr result
ID: Ophiopogon23_contig00006523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00006523 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021289286.1| uncharacterized protein LOC110420335 [Herran... 54 8e-06 >ref|XP_021289286.1| uncharacterized protein LOC110420335 [Herrania umbratica] Length = 409 Score = 53.5 bits (127), Expect = 8e-06 Identities = 27/43 (62%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = +1 Query: 226 SRARNGNGVRPLGLSNSAWPPLQKSHQQKQQPLA--GAGMTAV 348 +R RN N RPLGLS SAWPPLQ+ QQ+QQP G+GM AV Sbjct: 256 NRGRNSNSNRPLGLSPSAWPPLQQPQQQQQQPQPQNGSGMRAV 298