BLASTX nr result
ID: Ophiopogon23_contig00005471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00005471 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261734.1| protein root UVB sensitive 1, chloroplastic ... 75 7e-13 ref|XP_020261733.1| protein root UVB sensitive 1, chloroplastic ... 75 9e-13 ref|XP_020261732.1| protein root UVB sensitive 1, chloroplastic ... 75 9e-13 ref|XP_008797945.1| PREDICTED: protein root UVB sensitive 1, chl... 72 2e-11 ref|XP_019709210.1| PREDICTED: LOW QUALITY PROTEIN: protein root... 72 2e-11 gb|OAY71109.1| Protein root UVB sensitive 1, chloroplastic, part... 66 2e-10 gb|POF05657.1| protein root uvb sensitive 1, chloroplastic [Quer... 67 1e-09 ref|XP_023916353.1| protein root UVB sensitive 1, chloroplastic-... 67 1e-09 gb|ESR44158.1| hypothetical protein CICLE_v10012148mg [Citrus cl... 66 2e-09 ref|XP_020096525.1| protein root UVB sensitive 1, chloroplastic ... 66 2e-09 gb|KDO72277.1| hypothetical protein CISIN_1g045134mg, partial [C... 66 2e-09 dbj|GAY46278.1| hypothetical protein CUMW_095790 [Citrus unshiu] 66 2e-09 ref|XP_006482412.1| PREDICTED: protein root UVB sensitive 1, chl... 66 2e-09 ref|XP_024038599.1| protein root UVB sensitive 1, chloroplastic ... 66 2e-09 ref|XP_020096523.1| protein root UVB sensitive 1, chloroplastic ... 66 2e-09 ref|XP_007225553.2| protein root UVB sensitive 1, chloroplastic ... 66 2e-09 ref|XP_020096521.1| protein root UVB sensitive 1, chloroplastic ... 66 2e-09 ref|XP_008221121.1| PREDICTED: protein root UVB sensitive 1, chl... 65 3e-09 ref|XP_021822493.1| protein root UVB sensitive 1, chloroplastic ... 65 3e-09 gb|OVA20438.1| Vitamin B6 photo-protection and homoeostasis [Mac... 65 4e-09 >ref|XP_020261734.1| protein root UVB sensitive 1, chloroplastic isoform X3 [Asparagus officinalis] Length = 367 Score = 75.5 bits (184), Expect = 7e-13 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF HI+RDGL++GWLT++GLIARPLPNRIR+ +++ TS Sbjct: 320 ISLDYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 367 >ref|XP_020261733.1| protein root UVB sensitive 1, chloroplastic isoform X2 [Asparagus officinalis] Length = 407 Score = 75.5 bits (184), Expect = 9e-13 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF HI+RDGL++GWLT++GLIARPLPNRIR+ +++ TS Sbjct: 360 ISLDYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 407 >ref|XP_020261732.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK72746.1| uncharacterized protein A4U43_C04F22740 [Asparagus officinalis] Length = 410 Score = 75.5 bits (184), Expect = 9e-13 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF HI+RDGL++GWLT++GLIARPLPNRIR+ +++ TS Sbjct: 363 ISLDYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 410 >ref|XP_008797945.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Phoenix dactylifera] Length = 554 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYA 128 ISLDYVQREFSH++ DGL+SGW+T DGLIARPLP+RI +GYA Sbjct: 511 ISLDYVQREFSHVKHDGLQSGWVT-DGLIARPLPHRIHLGYA 551 >ref|XP_019709210.1| PREDICTED: LOW QUALITY PROTEIN: protein root UVB sensitive 1, chloroplastic [Elaeis guineensis] Length = 783 Score = 72.0 bits (175), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYA 128 ISLDYVQREFSH++ DGL+SGW+T DGLIARPLP RIR GYA Sbjct: 740 ISLDYVQREFSHVKHDGLQSGWMT-DGLIARPLPTRIRPGYA 780 >gb|OAY71109.1| Protein root UVB sensitive 1, chloroplastic, partial [Ananas comosus] Length = 150 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADS 134 ISLDYV+REFSH + DG +SGW T DGLIAR LPNRIR GYA S Sbjct: 107 ISLDYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 149 >gb|POF05657.1| protein root uvb sensitive 1, chloroplastic [Quercus suber] Length = 528 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISL+YVQREF+H++RDG GW+T DGL+ARPLP RIR+G+ S + S Sbjct: 482 ISLEYVQREFNHVKRDGESMGWVT-DGLVARPLPTRIRLGHVASSIAS 528 >ref|XP_023916353.1| protein root UVB sensitive 1, chloroplastic-like isoform X1 [Quercus suber] ref|XP_023916354.1| protein root UVB sensitive 1, chloroplastic-like isoform X1 [Quercus suber] Length = 622 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISL+YVQREF+H++RDG GW+T DGL+ARPLP RIR+G+ S + S Sbjct: 576 ISLEYVQREFNHVKRDGESMGWVT-DGLVARPLPTRIRLGHVASSIAS 622 >gb|ESR44158.1| hypothetical protein CICLE_v10012148mg [Citrus clementina] Length = 336 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF+H++ D GW+T DGLIARPLPNRIR GY + + S Sbjct: 290 ISLDYVQREFNHVKSDSASVGWVT-DGLIARPLPNRIRPGYVEPSVAS 336 >ref|XP_020096525.1| protein root UVB sensitive 1, chloroplastic isoform X4 [Ananas comosus] Length = 508 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADS 134 ISLDYV+REFSH + DG +SGW T DGLIAR LPNRIR GYA S Sbjct: 465 ISLDYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 507 >gb|KDO72277.1| hypothetical protein CISIN_1g045134mg, partial [Citrus sinensis] Length = 529 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF+H++ D GW+T DGLIARPLPNRIR GY + + S Sbjct: 483 ISLDYVQREFNHVKSDSASVGWVT-DGLIARPLPNRIRPGYVEPSVAS 529 >dbj|GAY46278.1| hypothetical protein CUMW_095790 [Citrus unshiu] Length = 586 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF+H++ D GW+T DGLIARPLPNRIR GY + + S Sbjct: 540 ISLDYVQREFNHVKSDSASVGWVT-DGLIARPLPNRIRPGYVEPSVAS 586 >ref|XP_006482412.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Citrus sinensis] Length = 586 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF+H++ D GW+T DGLIARPLPNRIR GY + + S Sbjct: 540 ISLDYVQREFNHVKSDSASVGWVT-DGLIARPLPNRIRPGYVEPSVAS 586 >ref|XP_024038599.1| protein root UVB sensitive 1, chloroplastic [Citrus clementina] Length = 588 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADSDLTS 146 ISLDYVQREF+H++ D GW+T DGLIARPLPNRIR GY + + S Sbjct: 542 ISLDYVQREFNHVKSDSASVGWVT-DGLIARPLPNRIRPGYVEPSVAS 588 >ref|XP_020096523.1| protein root UVB sensitive 1, chloroplastic isoform X2 [Ananas comosus] Length = 604 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADS 134 ISLDYV+REFSH + DG +SGW T DGLIAR LPNRIR GYA S Sbjct: 561 ISLDYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 603 >ref|XP_007225553.2| protein root UVB sensitive 1, chloroplastic [Prunus persica] gb|ONI32183.1| hypothetical protein PRUPE_1G352800 [Prunus persica] Length = 604 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGY 125 ISL+YVQREF+H++ DG GW+T DGLIARPLPNR+R+GY Sbjct: 556 ISLEYVQREFNHVKNDGESMGWVT-DGLIARPLPNRVRLGY 595 >ref|XP_020096521.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Ananas comosus] Length = 657 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADS 134 ISLDYV+REFSH + DG +SGW T DGLIAR LPNRIR GYA S Sbjct: 614 ISLDYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 656 >ref|XP_008221121.1| PREDICTED: protein root UVB sensitive 1, chloroplastic isoform X1 [Prunus mume] Length = 603 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGY 125 ISL+YVQREF+H++ DG GW+TE GLIARPLPNR+R+GY Sbjct: 555 ISLEYVQREFNHVKNDGESMGWVTE-GLIARPLPNRVRLGY 594 >ref|XP_021822493.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Prunus avium] Length = 607 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGY 125 ISL+YVQREF+H++ DG GW+T DGLIARPLPNR+R+GY Sbjct: 559 ISLEYVQREFNHVKNDGESVGWVT-DGLIARPLPNRVRLGY 598 >gb|OVA20438.1| Vitamin B6 photo-protection and homoeostasis [Macleaya cordata] Length = 400 Score = 65.1 bits (157), Expect = 4e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 ISLDYVQREFSHIRRDGLRSGWLTEDGLIARPLPNRIRIGYADS 134 ISLDYVQREF H++ DG +GW+TE GLIARPLPNRIR+ Y S Sbjct: 352 ISLDYVQREFDHVKHDGNLTGWVTE-GLIARPLPNRIRLDYMAS 394