BLASTX nr result
ID: Ophiopogon23_contig00005470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00005470 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261734.1| protein root UVB sensitive 1, chloroplastic ... 71 1e-11 ref|XP_020261733.1| protein root UVB sensitive 1, chloroplastic ... 71 2e-11 ref|XP_020261732.1| protein root UVB sensitive 1, chloroplastic ... 71 2e-11 ref|XP_008797945.1| PREDICTED: protein root UVB sensitive 1, chl... 66 1e-09 ref|XP_019709210.1| PREDICTED: LOW QUALITY PROTEIN: protein root... 66 1e-09 gb|OAY71109.1| Protein root UVB sensitive 1, chloroplastic, part... 60 2e-08 gb|POF05657.1| protein root uvb sensitive 1, chloroplastic [Quer... 60 7e-08 ref|XP_023916353.1| protein root UVB sensitive 1, chloroplastic-... 60 7e-08 gb|ESR44158.1| hypothetical protein CICLE_v10012148mg [Citrus cl... 60 1e-07 ref|XP_020096525.1| protein root UVB sensitive 1, chloroplastic ... 60 1e-07 gb|KDO72277.1| hypothetical protein CISIN_1g045134mg, partial [C... 60 1e-07 ref|XP_021897681.1| LOW QUALITY PROTEIN: protein root UVB sensit... 60 1e-07 dbj|GAY46278.1| hypothetical protein CUMW_095790 [Citrus unshiu] 60 1e-07 ref|XP_006482412.1| PREDICTED: protein root UVB sensitive 1, chl... 60 1e-07 ref|XP_024038599.1| protein root UVB sensitive 1, chloroplastic ... 60 1e-07 ref|XP_020096523.1| protein root UVB sensitive 1, chloroplastic ... 60 1e-07 ref|XP_007225553.2| protein root UVB sensitive 1, chloroplastic ... 60 1e-07 ref|XP_018827220.1| PREDICTED: protein root UVB sensitive 1, chl... 60 1e-07 ref|XP_020096521.1| protein root UVB sensitive 1, chloroplastic ... 60 1e-07 ref|XP_021822493.1| protein root UVB sensitive 1, chloroplastic ... 59 2e-07 >ref|XP_020261734.1| protein root UVB sensitive 1, chloroplastic isoform X3 [Asparagus officinalis] Length = 367 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF HI+RDGL++GWL+D+GLIARPLPNRIR+ +++ TS Sbjct: 323 DYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 367 >ref|XP_020261733.1| protein root UVB sensitive 1, chloroplastic isoform X2 [Asparagus officinalis] Length = 407 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF HI+RDGL++GWL+D+GLIARPLPNRIR+ +++ TS Sbjct: 363 DYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 407 >ref|XP_020261732.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK72746.1| uncharacterized protein A4U43_C04F22740 [Asparagus officinalis] Length = 410 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF HI+RDGL++GWL+D+GLIARPLPNRIR+ +++ TS Sbjct: 366 DYVQREFIHIKRDGLQNGWLTDEGLIARPLPNRIRLCFSEPAPTS 410 >ref|XP_008797945.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Phoenix dactylifera] Length = 554 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYA 308 DYVQREFSH++ DGL+SGW++ DGLIARPLP+RI +GYA Sbjct: 514 DYVQREFSHVKHDGLQSGWVT-DGLIARPLPHRIHLGYA 551 >ref|XP_019709210.1| PREDICTED: LOW QUALITY PROTEIN: protein root UVB sensitive 1, chloroplastic [Elaeis guineensis] Length = 783 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYA 308 DYVQREFSH++ DGL+SGW++ DGLIARPLP RIR GYA Sbjct: 743 DYVQREFSHVKHDGLQSGWMT-DGLIARPLPTRIRPGYA 780 >gb|OAY71109.1| Protein root UVB sensitive 1, chloroplastic, partial [Ananas comosus] Length = 150 Score = 59.7 bits (143), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADS 302 DYV+REFSH + DG +SGW + DGLIAR LPNRIR GYA S Sbjct: 110 DYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 149 >gb|POF05657.1| protein root uvb sensitive 1, chloroplastic [Quercus suber] Length = 528 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 +YVQREF+H++RDG GW++ DGL+ARPLP RIR+G+ S + S Sbjct: 485 EYVQREFNHVKRDGESMGWVT-DGLVARPLPTRIRLGHVASSIAS 528 >ref|XP_023916353.1| protein root UVB sensitive 1, chloroplastic-like isoform X1 [Quercus suber] ref|XP_023916354.1| protein root UVB sensitive 1, chloroplastic-like isoform X1 [Quercus suber] Length = 622 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 +YVQREF+H++RDG GW++ DGL+ARPLP RIR+G+ S + S Sbjct: 579 EYVQREFNHVKRDGESMGWVT-DGLVARPLPTRIRLGHVASSIAS 622 >gb|ESR44158.1| hypothetical protein CICLE_v10012148mg [Citrus clementina] Length = 336 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF+H++ D GW++D GLIARPLPNRIR GY + + S Sbjct: 293 DYVQREFNHVKSDSASVGWVTD-GLIARPLPNRIRPGYVEPSVAS 336 >ref|XP_020096525.1| protein root UVB sensitive 1, chloroplastic isoform X4 [Ananas comosus] Length = 508 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADS 302 DYV+REFSH + DG +SGW + DGLIAR LPNRIR GYA S Sbjct: 468 DYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 507 >gb|KDO72277.1| hypothetical protein CISIN_1g045134mg, partial [Citrus sinensis] Length = 529 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF+H++ D GW++D GLIARPLPNRIR GY + + S Sbjct: 486 DYVQREFNHVKSDSASVGWVTD-GLIARPLPNRIRPGYVEPSVAS 529 >ref|XP_021897681.1| LOW QUALITY PROTEIN: protein root UVB sensitive 1, chloroplastic [Carica papaya] Length = 559 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYV+REF+H++ D GW++D GLIARPL NRIR+GYA S TS Sbjct: 516 DYVRREFNHVKNDSESVGWIAD-GLIARPLSNRIRLGYAGSSPTS 559 >dbj|GAY46278.1| hypothetical protein CUMW_095790 [Citrus unshiu] Length = 586 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF+H++ D GW++D GLIARPLPNRIR GY + + S Sbjct: 543 DYVQREFNHVKSDSASVGWVTD-GLIARPLPNRIRPGYVEPSVAS 586 >ref|XP_006482412.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Citrus sinensis] Length = 586 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF+H++ D GW++D GLIARPLPNRIR GY + + S Sbjct: 543 DYVQREFNHVKSDSASVGWVTD-GLIARPLPNRIRPGYVEPSVAS 586 >ref|XP_024038599.1| protein root UVB sensitive 1, chloroplastic [Citrus clementina] Length = 588 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 DYVQREF+H++ D GW++D GLIARPLPNRIR GY + + S Sbjct: 545 DYVQREFNHVKSDSASVGWVTD-GLIARPLPNRIRPGYVEPSVAS 588 >ref|XP_020096523.1| protein root UVB sensitive 1, chloroplastic isoform X2 [Ananas comosus] Length = 604 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADS 302 DYV+REFSH + DG +SGW + DGLIAR LPNRIR GYA S Sbjct: 564 DYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 603 >ref|XP_007225553.2| protein root UVB sensitive 1, chloroplastic [Prunus persica] gb|ONI32183.1| hypothetical protein PRUPE_1G352800 [Prunus persica] Length = 604 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGY 311 +YVQREF+H++ DG GW++D GLIARPLPNR+R+GY Sbjct: 559 EYVQREFNHVKNDGESMGWVTD-GLIARPLPNRVRLGY 595 >ref|XP_018827220.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Juglans regia] ref|XP_018827221.1| PREDICTED: protein root UVB sensitive 1, chloroplastic [Juglans regia] Length = 642 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADSDLTS 290 +YVQREF+H++ DG GW+ D GLIARPLPNRIR+G A S S Sbjct: 599 EYVQREFNHVKNDGESVGWVMD-GLIARPLPNRIRVGNAASSFAS 642 >ref|XP_020096521.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Ananas comosus] Length = 657 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGYADS 302 DYV+REFSH + DG +SGW + DGLIAR LPNRIR GYA S Sbjct: 617 DYVRREFSHFKHDGKQSGWFT-DGLIARSLPNRIRPGYAVS 656 >ref|XP_021822493.1| protein root UVB sensitive 1, chloroplastic isoform X1 [Prunus avium] Length = 607 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 424 DYVQREFSHIRRDGLRSGWLSDDGLIARPLPNRIRIGY 311 +YVQREF+H++ DG GW++D GLIARPLPNR+R+GY Sbjct: 562 EYVQREFNHVKNDGESVGWVTD-GLIARPLPNRVRLGY 598