BLASTX nr result
ID: Ophiopogon23_contig00005328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00005328 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253066.1| LOW QUALITY PROTEIN: calmodulin-interacting ... 60 2e-07 >ref|XP_020253066.1| LOW QUALITY PROTEIN: calmodulin-interacting protein 111 [Asparagus officinalis] Length = 1022 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 18 EVAMRHFKIAIGKVHPTDVQYYSELAARFRRFVDGGFSTDG 140 E++M+HFKI IG+VHP+D Q+Y ELA FRR VD G DG Sbjct: 982 EISMKHFKIGIGRVHPSDAQFYRELATHFRRIVDSGSPRDG 1022