BLASTX nr result
ID: Ophiopogon23_contig00005019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00005019 (520 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256085.1| FRIGIDA-like protein 4a [Asparagus officinal... 60 2e-07 >ref|XP_020256085.1| FRIGIDA-like protein 4a [Asparagus officinalis] gb|ONK74324.1| uncharacterized protein A4U43_C03F5070 [Asparagus officinalis] Length = 523 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 520 IGVSYSSAQMNYPHYGAYTNGLAPGYQQAYY 428 IGV+YSS M YPHYGAY NGLAPGYQQAYY Sbjct: 492 IGVAYSSPPMTYPHYGAYGNGLAPGYQQAYY 522