BLASTX nr result
ID: Ophiopogon23_contig00005010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00005010 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251403.1| CTP synthase-like isoform X1 [Asparagus offi... 44 8e-09 ref|XP_020251404.1| CTP synthase-like isoform X2 [Asparagus offi... 44 8e-09 ref|XP_020251406.1| CTP synthase-like isoform X3 [Asparagus offi... 44 8e-09 ref|XP_020251407.1| CTP synthase-like isoform X4 [Asparagus offi... 44 8e-09 ref|XP_020251408.1| CTP synthase-like isoform X5 [Asparagus offi... 44 8e-09 ref|XP_017697254.1| PREDICTED: CTP synthase [Phoenix dactylifera] 45 1e-08 ref|XP_010915634.1| PREDICTED: CTP synthase [Elaeis guineensis] 45 1e-08 ref|XP_015865757.1| PREDICTED: CTP synthase-like, partial [Zizip... 44 4e-08 gb|AAD32937.1|AC004135_12 T17H7.12 [Arabidopsis thaliana] 44 5e-08 ref|XP_023517789.1| CTP synthase-like [Cucurbita pepo subsp. pepo] 44 5e-08 ref|XP_023003630.1| CTP synthase-like [Cucurbita maxima] 44 5e-08 ref|XP_022926543.1| CTP synthase-like [Cucurbita moschata] 44 5e-08 ref|XP_020869701.1| CTP synthase isoform X1 [Arabidopsis lyrata ... 45 8e-08 ref|XP_023645795.1| CTP synthase isoform X1 [Capsella rubella] 45 1e-07 ref|XP_022146521.1| CTP synthase-like [Momordica charantia] 44 1e-07 gb|PKA58953.1| CTP synthase [Apostasia shenzhenica] 44 1e-07 ref|XP_010913356.1| PREDICTED: CTP synthase isoform X1 [Elaeis g... 44 2e-07 ref|XP_010913365.1| PREDICTED: CTP synthase isoform X2 [Elaeis g... 44 2e-07 ref|XP_019709507.1| PREDICTED: CTP synthase 1 isoform X3 [Elaeis... 44 2e-07 ref|XP_008798430.1| PREDICTED: CTP synthase isoform X1 [Phoenix ... 41 3e-07 >ref|XP_020251403.1| CTP synthase-like isoform X1 [Asparagus officinalis] gb|ONK81144.1| uncharacterized protein A4U43_C01F25760 [Asparagus officinalis] Length = 595 Score = 43.9 bits (102), Expect(2) = 8e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L+EWT RAEICD+LQNP+ Sbjct: 275 VAVEPMLEEWTARAEICDTLQNPV 298 Score = 43.5 bits (101), Expect(2) = 8e-09 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251404.1| CTP synthase-like isoform X2 [Asparagus officinalis] Length = 511 Score = 43.9 bits (102), Expect(2) = 8e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L+EWT RAEICD+LQNP+ Sbjct: 275 VAVEPMLEEWTARAEICDTLQNPV 298 Score = 43.5 bits (101), Expect(2) = 8e-09 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251406.1| CTP synthase-like isoform X3 [Asparagus officinalis] Length = 466 Score = 43.9 bits (102), Expect(2) = 8e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L+EWT RAEICD+LQNP+ Sbjct: 275 VAVEPMLEEWTARAEICDTLQNPV 298 Score = 43.5 bits (101), Expect(2) = 8e-09 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251407.1| CTP synthase-like isoform X4 [Asparagus officinalis] Length = 465 Score = 43.9 bits (102), Expect(2) = 8e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L+EWT RAEICD+LQNP+ Sbjct: 275 VAVEPMLEEWTARAEICDTLQNPV 298 Score = 43.5 bits (101), Expect(2) = 8e-09 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_020251408.1| CTP synthase-like isoform X5 [Asparagus officinalis] Length = 461 Score = 43.9 bits (102), Expect(2) = 8e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L+EWT RAEICD+LQNP+ Sbjct: 275 VAVEPMLEEWTARAEICDTLQNPV 298 Score = 43.5 bits (101), Expect(2) = 8e-09 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 >ref|XP_017697254.1| PREDICTED: CTP synthase [Phoenix dactylifera] Length = 605 Score = 45.4 bits (106), Expect(2) = 1e-08 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VAGEPKLDEW +RAEICD+L P+ Sbjct: 275 VAGEPKLDEWVSRAEICDTLHEPV 298 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGL DSYLSVLK Sbjct: 298 VRIAMVGKYTGLPDSYLSVLK 318 >ref|XP_010915634.1| PREDICTED: CTP synthase [Elaeis guineensis] Length = 605 Score = 45.1 bits (105), Expect(2) = 1e-08 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +AGEPKLDEW +RAEICD+L P+ Sbjct: 275 IAGEPKLDEWVSRAEICDTLHEPV 298 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGL DSYLSVLK Sbjct: 298 VRIAMVGKYTGLPDSYLSVLK 318 >ref|XP_015865757.1| PREDICTED: CTP synthase-like, partial [Ziziphus jujuba] Length = 545 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 232 VRIAMVGKYTGLSDSYLSVLK 252 Score = 41.6 bits (96), Expect(2) = 4e-08 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VAGEP L+EWT+RAEICD++ P+ Sbjct: 209 VAGEPDLEEWTSRAEICDTVLEPV 232 >gb|AAD32937.1|AC004135_12 T17H7.12 [Arabidopsis thaliana] Length = 654 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +1 Query: 166 LQVRIAMVGKYTGLSDSYLSVLK 234 LQVRIA+VGKYTGLSD+YLSVLK Sbjct: 350 LQVRIAVVGKYTGLSDAYLSVLK 372 Score = 40.4 bits (93), Expect(2) = 5e-08 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPIG-SDHMKFLNKD 107 + EP L EWT+RAE+CD+L P+G S + F N++ Sbjct: 303 ILNEPSLGEWTSRAELCDNLHVPVGLSSQLLFRNRN 338 >ref|XP_023517789.1| CTP synthase-like [Cucurbita pepo subsp. pepo] Length = 602 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 Score = 41.2 bits (95), Expect(2) = 5e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +AG P L+EWT RAEICDSL P+ Sbjct: 275 IAGGPALEEWTARAEICDSLHEPV 298 >ref|XP_023003630.1| CTP synthase-like [Cucurbita maxima] Length = 602 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 Score = 41.2 bits (95), Expect(2) = 5e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +AG P L+EWT RAEICDSL P+ Sbjct: 275 IAGGPALEEWTARAEICDSLHEPV 298 >ref|XP_022926543.1| CTP synthase-like [Cucurbita moschata] Length = 602 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 Score = 41.2 bits (95), Expect(2) = 5e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +AG P L+EWT RAEICDSL P+ Sbjct: 275 IAGGPALEEWTARAEICDSLHEPV 298 >ref|XP_020869701.1| CTP synthase isoform X1 [Arabidopsis lyrata subsp. lyrata] Length = 626 Score = 45.4 bits (106), Expect(2) = 8e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 145 SHNMLFNLQVRIAMVGKYTGLSDSYLSVLK 234 +H M+ LQVRIA+VGKYTGLSD+YLSVLK Sbjct: 317 THQMI--LQVRIAVVGKYTGLSDAYLSVLK 344 Score = 38.5 bits (88), Expect(2) = 8e-08 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPIG 77 + EP L EWT+RAE+CD+L P+G Sbjct: 275 ILNEPSLGEWTSRAELCDNLHVPVG 299 >ref|XP_023645795.1| CTP synthase isoform X1 [Capsella rubella] Length = 626 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 157 LFNLQVRIAMVGKYTGLSDSYLSVLK 234 L LQVRIA+VGKYTGLSD+YLSVLK Sbjct: 319 LIILQVRIAVVGKYTGLSDAYLSVLK 344 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 12 EPKLDEWTTRAEICDSLQNPIGSDHMKFLNKDESLVPFYSGII 140 EP L EWT+RAE+CD+L P+G L + F +I Sbjct: 278 EPSLGEWTSRAELCDNLHVPVGLSSQLLLRNCNLNISFLKHLI 320 >ref|XP_022146521.1| CTP synthase-like [Momordica charantia] Length = 602 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +A +P L+EWTTRA+ICDSL P+ Sbjct: 275 IACDPALEEWTTRAKICDSLHEPV 298 >gb|PKA58953.1| CTP synthase [Apostasia shenzhenica] Length = 572 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 163 NLQVRIAMVGKYTGLSDSYLSVLK 234 ++ VRIAMVGKYTGLSDSYLSVLK Sbjct: 295 HIPVRIAMVGKYTGLSDSYLSVLK 318 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 +AGEP ++EWT+RA ICD+L P+ Sbjct: 275 IAGEPLMEEWTSRARICDTLHIPV 298 >ref|XP_010913356.1| PREDICTED: CTP synthase isoform X1 [Elaeis guineensis] Length = 617 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 314 VRIAMVGKYTGLSDSYLSVLK 334 Score = 38.9 bits (89), Expect(2) = 2e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L EWT RAE+CDSL +P+ Sbjct: 291 VAREPNLVEWTDRAELCDSLHDPV 314 >ref|XP_010913365.1| PREDICTED: CTP synthase isoform X2 [Elaeis guineensis] Length = 601 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 298 VRIAMVGKYTGLSDSYLSVLK 318 Score = 38.9 bits (89), Expect(2) = 2e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L EWT RAE+CDSL +P+ Sbjct: 275 VAREPNLVEWTDRAELCDSLHDPV 298 >ref|XP_019709507.1| PREDICTED: CTP synthase 1 isoform X3 [Elaeis guineensis] Length = 568 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSVLK Sbjct: 265 VRIAMVGKYTGLSDSYLSVLK 285 Score = 38.9 bits (89), Expect(2) = 2e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP L EWT RAE+CDSL +P+ Sbjct: 242 VAREPNLVEWTDRAELCDSLHDPV 265 >ref|XP_008798430.1| PREDICTED: CTP synthase isoform X1 [Phoenix dactylifera] Length = 627 Score = 41.2 bits (95), Expect(2) = 3e-07 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +1 Query: 172 VRIAMVGKYTGLSDSYLSVLK 234 VRIAMVGKYTGLSDSYLSV K Sbjct: 314 VRIAMVGKYTGLSDSYLSVWK 334 Score = 40.8 bits (94), Expect(2) = 3e-07 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +3 Query: 3 VAGEPKLDEWTTRAEICDSLQNPI 74 VA EP LDEWT RA++CDSL +P+ Sbjct: 291 VAREPDLDEWTNRAKLCDSLHDPV 314