BLASTX nr result
ID: Ophiopogon23_contig00004827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00004827 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020692236.1| 60S ribosomal protein L29-1-like [Dendrobium... 68 1e-12 ref|XP_018676128.1| PREDICTED: 60S ribosomal protein L29-1-like ... 68 1e-12 ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phas... 67 2e-12 gb|PIN05352.1| 60S ribosomal protein L29 [Handroanthus impetigin... 67 3e-12 ref|XP_018685696.1| PREDICTED: 60S ribosomal protein L29-1-like ... 67 3e-12 ref|XP_022959482.1| 60S ribosomal protein L29-1-like [Cucurbita ... 67 4e-12 ref|XP_022849321.1| 60S ribosomal protein L29-1 [Olea europaea v... 67 4e-12 gb|PIN12859.1| 60S ribosomal protein L29 [Handroanthus impetigin... 67 4e-12 gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] 67 4e-12 ref|XP_007035751.1| PREDICTED: 60S ribosomal protein L29-1 [Theo... 67 4e-12 ref|XP_014499184.1| 60S ribosomal protein L29-1 [Vigna radiata v... 66 5e-12 ref|XP_002519200.1| PREDICTED: 60S ribosomal protein L29-1 [Rici... 66 5e-12 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 66 5e-12 ref|XP_020268382.1| 60S ribosomal protein L29-1-like [Asparagus ... 66 5e-12 ref|XP_020095424.1| 60S ribosomal protein L29-1-like [Ananas com... 66 5e-12 ref|XP_023000056.1| 60S ribosomal protein L29-1-like [Cucurbita ... 66 7e-12 gb|OIW00142.1| hypothetical protein TanjilG_29132 [Lupinus angus... 66 7e-12 ref|XP_017429849.1| PREDICTED: 60S ribosomal protein L29-1-like ... 66 7e-12 ref|XP_017409783.1| PREDICTED: 60S ribosomal protein L29-1 [Vign... 66 7e-12 ref|XP_012084042.1| 60S ribosomal protein L29-1 [Jatropha curcas... 66 7e-12 >ref|XP_020692236.1| 60S ribosomal protein L29-1-like [Dendrobium catenatum] Length = 62 Score = 67.8 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 387 TSTKGMDPKFLRNQRYARKHNKKSGEAGSEQEE 289 TSTKGMDPKFLRNQRYARKHNKKSGE+GSE EE Sbjct: 30 TSTKGMDPKFLRNQRYARKHNKKSGESGSEAEE 62 >ref|XP_018676128.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] ref|XP_018676129.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] Length = 62 Score = 67.8 bits (164), Expect = 1e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQEE 289 HTSTKGMDPKFLRNQRYARKHNKK+G +GSE EE Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKNGASGSEMEE 62 >ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] ref|XP_007154358.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] ref|XP_014508057.1| 60S ribosomal protein L29-1 [Vigna radiata var. radiata] gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 67.4 bits (163), Expect = 2e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKKSGE SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKSGETASEEE 61 >gb|PIN05352.1| 60S ribosomal protein L29 [Handroanthus impetiginosus] Length = 61 Score = 67.0 bits (162), Expect = 3e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNK SGEA SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKNSGEAASEEE 61 >ref|XP_018685696.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] ref|XP_018685697.1| PREDICTED: 60S ribosomal protein L29-1-like [Musa acuminata subsp. malaccensis] Length = 62 Score = 67.0 bits (162), Expect = 3e-12 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQEE 289 HTSTKGMDPKFLRNQRYARKHNKK G +GSE EE Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKDGVSGSEMEE 62 >ref|XP_022959482.1| 60S ribosomal protein L29-1-like [Cucurbita moschata] ref|XP_022959483.1| 60S ribosomal protein L29-1-like [Cucurbita moschata] ref|XP_023006357.1| 60S ribosomal protein L29-1-like [Cucurbita maxima] ref|XP_023006358.1| 60S ribosomal protein L29-1-like [Cucurbita maxima] ref|XP_023549485.1| 60S ribosomal protein L29-1-like [Cucurbita pepo subsp. pepo] Length = 61 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYA+KHN KSGE GSE+E Sbjct: 29 HTSTKGMDPKFLRNQRYAKKHNNKSGETGSEEE 61 >ref|XP_022849321.1| 60S ribosomal protein L29-1 [Olea europaea var. sylvestris] ref|XP_022849322.1| 60S ribosomal protein L29-1 [Olea europaea var. sylvestris] Length = 61 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKKSGE+ +E+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >gb|PIN12859.1| 60S ribosomal protein L29 [Handroanthus impetiginosus] Length = 61 Score = 66.6 bits (161), Expect = 4e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHN KSGEA SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNTKSGEAASEEE 61 >gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 66.6 bits (161), Expect = 4e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHN KSGEAGS +E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNNKSGEAGSGEE 61 >ref|XP_007035751.1| PREDICTED: 60S ribosomal protein L29-1 [Theobroma cacao] ref|XP_012455658.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] ref|XP_012455659.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] ref|XP_012455660.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium raimondii] ref|XP_016677307.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium hirsutum] ref|XP_016677308.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium hirsutum] ref|XP_017646946.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium arboreum] ref|XP_017646947.1| PREDICTED: 60S ribosomal protein L29-1 [Gossypium arboreum] ref|XP_021291435.1| 60S ribosomal protein L29-1 [Herrania umbratica] ref|XP_022761267.1| 60S ribosomal protein L29-1 [Durio zibethinus] gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] gb|KHG07587.1| 60S ribosomal L29-1 -like protein [Gossypium arboreum] Length = 61 Score = 66.6 bits (161), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKKSGE+ +E+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >ref|XP_014499184.1| 60S ribosomal protein L29-1 [Vigna radiata var. radiata] Length = 61 Score = 66.2 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKK+GE SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKNGETASEEE 61 >ref|XP_002519200.1| PREDICTED: 60S ribosomal protein L29-1 [Ricinus communis] gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 66.2 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKKSGE +E+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] ref|XP_020208104.1| 60S ribosomal protein L29-1 [Cajanus cajan] ref|XP_020228391.1| 60S ribosomal protein L29-1 [Cajanus cajan] ref|XP_021608152.1| 60S ribosomal protein L29-1 [Manihot esculenta] ref|XP_021637038.1| 60S ribosomal protein L29-1 [Hevea brasiliensis] ref|XP_021637148.1| 60S ribosomal protein L29-1 [Hevea brasiliensis] gb|KHN02910.1| 60S ribosomal protein L29-1 [Glycine soja] gb|KHN03309.1| 60S ribosomal protein L29-1 [Glycine soja] gb|KHN12895.1| 60S ribosomal protein L29-1 [Glycine soja] gb|KRH02330.1| hypothetical protein GLYMA_17G032200 [Glycine max] gb|KRH02331.1| hypothetical protein GLYMA_17G032200 [Glycine max] gb|KRH37007.1| hypothetical protein GLYMA_09G038100 [Glycine max] gb|KRH50758.1| hypothetical protein GLYMA_07G241700 [Glycine max] gb|KYP32819.1| 60S ribosomal protein L29-1 [Cajanus cajan] gb|OAY56097.1| hypothetical protein MANES_03G202400 [Manihot esculenta] Length = 61 Score = 66.2 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKKSGE +E+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_020268382.1| 60S ribosomal protein L29-1-like [Asparagus officinalis] Length = 62 Score = 66.2 bits (160), Expect = 5e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQEE 289 + STKGMDPKFLRNQRYARKHNKK+ EAGSEQEE Sbjct: 29 NASTKGMDPKFLRNQRYARKHNKKNAEAGSEQEE 62 >ref|XP_020095424.1| 60S ribosomal protein L29-1-like [Ananas comosus] Length = 62 Score = 66.2 bits (160), Expect = 5e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 387 TSTKGMDPKFLRNQRYARKHNKKSGEAGSEQEE 289 TSTKGMDPKFLRNQRYARKHNKK+GE+GSE EE Sbjct: 30 TSTKGMDPKFLRNQRYARKHNKKAGESGSEGEE 62 >ref|XP_023000056.1| 60S ribosomal protein L29-1-like [Cucurbita maxima] Length = 61 Score = 65.9 bits (159), Expect = 7e-12 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYA+KHN KSGE+G+E+E Sbjct: 29 HTSTKGMDPKFLRNQRYAKKHNNKSGESGTEEE 61 >gb|OIW00142.1| hypothetical protein TanjilG_29132 [Lupinus angustifolius] Length = 61 Score = 65.9 bits (159), Expect = 7e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKK GEA SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKDGEAISEEE 61 >ref|XP_017429849.1| PREDICTED: 60S ribosomal protein L29-1-like [Vigna angularis] gb|KOM33445.1| hypothetical protein LR48_Vigan01g300100 [Vigna angularis] Length = 61 Score = 65.9 bits (159), Expect = 7e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNK+SGE SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKQSGETASEEE 61 >ref|XP_017409783.1| PREDICTED: 60S ribosomal protein L29-1 [Vigna angularis] gb|KOM29161.1| hypothetical protein LR48_Vigan635s008600 [Vigna angularis] Length = 61 Score = 65.9 bits (159), Expect = 7e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHNKK GE SE+E Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNKKDGETASEEE 61 >ref|XP_012084042.1| 60S ribosomal protein L29-1 [Jatropha curcas] gb|KDP27893.1| hypothetical protein JCGZ_18973 [Jatropha curcas] Length = 61 Score = 65.9 bits (159), Expect = 7e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 390 HTSTKGMDPKFLRNQRYARKHNKKSGEAGSEQE 292 HTSTKGMDPKFLRNQRYARKHN KSG++ SEQE Sbjct: 29 HTSTKGMDPKFLRNQRYARKHNNKSGDSASEQE 61