BLASTX nr result
ID: Ophiopogon23_contig00004351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00004351 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241724.1| pantothenate kinase 1-like isoform X2 [Aspar... 67 4e-10 ref|XP_020241723.1| pantothenate kinase 1-like isoform X1 [Aspar... 67 5e-10 gb|ONK61271.1| uncharacterized protein A4U43_C08F27970 [Asparagu... 67 5e-10 ref|XP_020677240.1| pantothenate kinase 1-like [Dendrobium caten... 54 1e-06 ref|XP_010932471.1| PREDICTED: pantothenate kinase 1 [Elaeis gui... 55 7e-06 >ref|XP_020241724.1| pantothenate kinase 1-like isoform X2 [Asparagus officinalis] Length = 535 Score = 66.6 bits (161), Expect = 4e-10 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 3 HEKNDETDLRRELEKLQHNNAELGAEVERLKRENSELTARLEKLQL 140 H K+DET+LR E+E L+H+NAEL AEVERL++E SEL ARLEKLQL Sbjct: 483 HGKDDETNLRGEIESLKHSNAELRAEVERLEQEKSELKARLEKLQL 528 >ref|XP_020241723.1| pantothenate kinase 1-like isoform X1 [Asparagus officinalis] Length = 655 Score = 66.6 bits (161), Expect = 5e-10 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 3 HEKNDETDLRRELEKLQHNNAELGAEVERLKRENSELTARLEKLQL 140 H K+DET+LR E+E L+H+NAEL AEVERL++E SEL ARLEKLQL Sbjct: 603 HGKDDETNLRGEIESLKHSNAELRAEVERLEQEKSELKARLEKLQL 648 >gb|ONK61271.1| uncharacterized protein A4U43_C08F27970 [Asparagus officinalis] Length = 711 Score = 66.6 bits (161), Expect = 5e-10 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 3 HEKNDETDLRRELEKLQHNNAELGAEVERLKRENSELTARLEKLQL 140 H K+DET+LR E+E L+H+NAEL AEVERL++E SEL ARLEKLQL Sbjct: 659 HGKDDETNLRGEIESLKHSNAELRAEVERLEQEKSELKARLEKLQL 704 >ref|XP_020677240.1| pantothenate kinase 1-like [Dendrobium catenatum] gb|PKU60328.1| hypothetical protein MA16_Dca028659 [Dendrobium catenatum] Length = 96 Score = 53.5 bits (127), Expect = 1e-06 Identities = 24/45 (53%), Positives = 37/45 (82%) Frame = +3 Query: 15 DETDLRRELEKLQHNNAELGAEVERLKRENSELTARLEKLQLDHR 149 +E+ L+ E+++L+HNNAEL AE+ERLK+EN EL + L KLQ+ ++ Sbjct: 50 NESSLKEEVKRLRHNNAELRAELERLKQENIELKSALSKLQIKNK 94 >ref|XP_010932471.1| PREDICTED: pantothenate kinase 1 [Elaeis guineensis] Length = 669 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 3 HEKNDETDLRRELEKLQHNNAELGAEVERLKRENSELTARLEKLQLD 143 +E NDE + E+EKLQH+NAEL EVERL+REN EL A+LEK + D Sbjct: 624 YESNDE-NFNVEIEKLQHDNAELKHEVERLRRENEELKAKLEKSRDD 669