BLASTX nr result
ID: Ophiopogon23_contig00003667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00003667 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL69374.1|AF462211_1 putative pectinesterase, partial [Narci... 61 1e-09 ref|XP_018821446.1| PREDICTED: pectin acetylesterase 8-like [Jug... 66 2e-09 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] 65 4e-09 ref|XP_021812222.1| pectin acetylesterase 8-like [Prunus avium] ... 65 4e-09 ref|XP_024031265.1| LOW QUALITY PROTEIN: pectin acetylesterase 8... 65 4e-09 ref|XP_022737901.1| pectin acetylesterase 8-like isoform X3 [Dur... 65 4e-09 ref|XP_022737900.1| pectin acetylesterase 8-like isoform X2 [Dur... 65 5e-09 ref|XP_022737899.1| pectin acetylesterase 8-like isoform X1 [Dur... 65 5e-09 ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fra... 65 6e-09 ref|XP_018849186.1| PREDICTED: pectin acetylesterase 8-like [Jug... 65 8e-09 ref|XP_018832508.1| PREDICTED: pectin acetylesterase 8-like [Jug... 65 8e-09 gb|PON68582.1| Pectinacetylesterase/NOTUM [Parasponia andersonii] 65 8e-09 gb|PON41374.1| Pectinacetylesterase/NOTUM [Trema orientalis] 65 8e-09 ref|XP_018505030.1| PREDICTED: pectin acetylesterase 8-like isof... 64 1e-08 ref|XP_018505028.1| PREDICTED: pectin acetylesterase 8-like isof... 64 1e-08 ref|XP_018505027.1| PREDICTED: pectin acetylesterase 8-like isof... 64 2e-08 ref|XP_008373439.1| PREDICTED: pectin acetylesterase 8 isoform X... 64 2e-08 ref|XP_008373438.1| PREDICTED: pectin acetylesterase 8 isoform X... 64 2e-08 gb|ACF05806.1| PAE [Litchi chinensis] 64 2e-08 ref|XP_022136630.1| pectin acetylesterase 8-like isoform X2 [Mom... 63 3e-08 >gb|AAL69374.1|AF462211_1 putative pectinesterase, partial [Narcissus pseudonarcissus] Length = 47 Score = 61.2 bits (147), Expect = 1e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 222 TIADAVGNWFYDRSSFQKIDCPYPCNPSC 136 T+A+AVGNWFYDRSS QKIDCPYPC+ SC Sbjct: 13 TVAEAVGNWFYDRSSCQKIDCPYPCDTSC 41 >ref|XP_018821446.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 399 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVGNWFYDRS FQKIDCPYPCNP+C+ Sbjct: 357 TTIARAVGNWFYDRSPFQKIDCPYPCNPTCH 387 >gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] Length = 386 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS+FQKIDCPYPCNP+C+ Sbjct: 345 TTIAKAVGDWFYDRSAFQKIDCPYPCNPTCH 375 >ref|XP_021812222.1| pectin acetylesterase 8-like [Prunus avium] ref|XP_021812223.1| pectin acetylesterase 8-like [Prunus avium] Length = 400 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVGNWFYDR+ FQKIDCPYPCNP+C+ Sbjct: 357 TTIAKAVGNWFYDRTPFQKIDCPYPCNPTCH 387 >ref|XP_024031265.1| LOW QUALITY PROTEIN: pectin acetylesterase 8 [Morus notabilis] Length = 401 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS+FQKIDCPYPCNP+C+ Sbjct: 360 TTIAKAVGDWFYDRSAFQKIDCPYPCNPTCH 390 >ref|XP_022737901.1| pectin acetylesterase 8-like isoform X3 [Durio zibethinus] ref|XP_022737902.1| pectin acetylesterase 8-like isoform X3 [Durio zibethinus] Length = 402 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 357 TTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 387 >ref|XP_022737900.1| pectin acetylesterase 8-like isoform X2 [Durio zibethinus] Length = 428 Score = 65.5 bits (158), Expect = 5e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 383 TTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 413 >ref|XP_022737899.1| pectin acetylesterase 8-like isoform X1 [Durio zibethinus] Length = 454 Score = 65.5 bits (158), Expect = 5e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 409 TTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 439 >ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] Length = 399 Score = 65.1 bits (157), Expect = 6e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 358 TTIARAVGDWFYDRTSFQKIDCPYPCNPTCH 388 >ref|XP_018849186.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 399 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 357 TTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 387 >ref|XP_018832508.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] ref|XP_018832514.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 400 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 358 TTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 388 >gb|PON68582.1| Pectinacetylesterase/NOTUM [Parasponia andersonii] Length = 403 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 362 TTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 392 >gb|PON41374.1| Pectinacetylesterase/NOTUM [Trema orientalis] Length = 403 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 362 TTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 392 >ref|XP_018505030.1| PREDICTED: pectin acetylesterase 8-like isoform X3 [Pyrus x bretschneideri] Length = 405 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCYTES 124 +TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ + Sbjct: 324 TTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRN 357 >ref|XP_018505028.1| PREDICTED: pectin acetylesterase 8-like isoform X2 [Pyrus x bretschneideri] Length = 411 Score = 63.9 bits (154), Expect = 1e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCYTES 124 +TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ + Sbjct: 357 TTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRN 390 >ref|XP_018505027.1| PREDICTED: pectin acetylesterase 8-like isoform X1 [Pyrus x bretschneideri] ref|XP_018505029.1| PREDICTED: pectin acetylesterase 8-like isoform X1 [Pyrus x bretschneideri] Length = 438 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCYTES 124 +TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ + Sbjct: 357 TTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRN 390 >ref|XP_008373439.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_008373440.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_017188510.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_017188511.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] Length = 438 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCYTES 124 +TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ + Sbjct: 357 TTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRN 390 >ref|XP_008373438.1| PREDICTED: pectin acetylesterase 8 isoform X1 [Malus domestica] Length = 466 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCYTES 124 +TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ + Sbjct: 385 TTIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRN 418 >gb|ACF05806.1| PAE [Litchi chinensis] Length = 399 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+W+YDRS FQKIDCPYPCNP+C+ Sbjct: 357 TTIAKAVGDWYYDRSPFQKIDCPYPCNPTCH 387 >ref|XP_022136630.1| pectin acetylesterase 8-like isoform X2 [Momordica charantia] ref|XP_022136631.1| pectin acetylesterase 8-like isoform X2 [Momordica charantia] Length = 398 Score = 63.2 bits (152), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 225 STIADAVGNWFYDRSSFQKIDCPYPCNPSCY 133 +TIA AVG+WF+DRS FQKIDCPYPCNP+C+ Sbjct: 357 TTIAKAVGDWFFDRSPFQKIDCPYPCNPTCH 387