BLASTX nr result
ID: Ophiopogon23_contig00002726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00002726 (2796 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65797.1| uncharacterized protein A4U43_C06F1070 [Asparagus... 61 4e-06 >gb|ONK65797.1| uncharacterized protein A4U43_C06F1070 [Asparagus officinalis] Length = 281 Score = 60.8 bits (146), Expect = 4e-06 Identities = 31/76 (40%), Positives = 45/76 (59%) Frame = -2 Query: 1559 YFLNPQSFSCHQSSHVRNDMFAERRHQALRSCMEGLTQAVRLQCASIPQRHVQPRIGYGL 1380 Y N Q ++ HQ+ H R D E R + + S ++G Q +++ +SIPQRH QPR Y Sbjct: 58 YLANLQGYNRHQNVHARIDRDNEARREIVMSSVQGPVQPTQVRYSSIPQRHFQPRPRYVP 117 Query: 1379 WPTQTMNGSMSRGGKI 1332 + TQ+MNG + RG I Sbjct: 118 YHTQSMNGLVPRGQSI 133