BLASTX nr result
ID: Ophiopogon23_contig00002398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00002398 (1163 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus... 68 5e-21 gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus... 70 4e-11 ref|XP_020272581.1| uncharacterized protein LOC109847759 isoform... 50 1e-10 gb|ONK64366.1| uncharacterized protein A4U43_C07F25060 [Asparagu... 50 1e-10 ref|XP_020272580.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272582.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272583.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272584.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272585.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272586.1| uncharacterized protein LOC109847759 isoform... 49 3e-10 ref|XP_020272587.1| phosphatidylinositol N-acetylglucosaminyltra... 49 3e-10 ref|XP_020262950.1| uncharacterized protein LOC109838930 isoform... 47 4e-09 >gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus officinalis] Length = 231 Score = 68.2 bits (165), Expect(3) = 5e-21 Identities = 33/88 (37%), Positives = 48/88 (54%) Frame = +1 Query: 526 PSRGWLKINFDGARKHDGPKSGASFVCRNADAALIAAATVPTIDNDINSIELAAAWNDLH 705 P W+KINFDGA K D K+G F+ R A + ++AA +P ++N EL W+ L Sbjct: 102 PRDNWIKINFDGACKLDSSKAGTGFLIRCAGSPILAATAIPIDHIEVNYAELIGDWSALT 161 Query: 706 WIYKNFRHVRFGSKVTPKFTVDLLNRDP 789 W YK + + K +DLL++DP Sbjct: 162 WCYKRYGTCLVWIEGDSKHVLDLLSKDP 189 Score = 42.7 bits (99), Expect(3) = 5e-21 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +2 Query: 314 ALTAWHLWLDRNNVVFNNRVKSINDIFETVNYLVIDPSGS 433 A TAW L LDRNN VFNN+++ IFE+ N LV++ S Sbjct: 27 AYTAWLLLLDRNNSVFNNQMRPNEAIFESCNSLVLEQFAS 66 Score = 40.0 bits (92), Expect(3) = 5e-21 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +3 Query: 429 EAEVDDLGLLLDWGMQPTVAPIKQPFVIQWHPPKPGVVK 545 EA ++L LL+ WG++PT+ + P ++ W PP+ +K Sbjct: 70 EAPQEELSLLMAWGLRPTITNSQAPTMVAWEPPRDNWIK 108 >gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus officinalis] Length = 126 Score = 70.5 bits (171), Expect = 4e-11 Identities = 35/97 (36%), Positives = 53/97 (54%) Frame = +1 Query: 526 PSRGWLKINFDGARKHDGPKSGASFVCRNADAALIAAATVPTIDNDINSIELAAAWNDLH 705 P W+KINFDGA K D ++G F+ R A + ++AAA +P ++N EL AW+ L Sbjct: 7 PMDNWIKINFDGACKLDSSQAGTGFLIRCAGSPILAAAAIPIDHIEVNYAELIGAWSALT 66 Query: 706 WIYKNFRHVRFGSKVTPKFTVDLLNRDPKASDDPILS 816 W YK + + K +DLL+++P +D S Sbjct: 67 WCYKRYGACLVWIEGDSKHVLDLLSKEPYHTDSQFWS 103 >ref|XP_020272581.1| uncharacterized protein LOC109847759 isoform X2 [Asparagus officinalis] Length = 724 Score = 50.4 bits (119), Expect(2) = 1e-10 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T+VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 653 TIVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 692 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 696 RQALPWMQISCWEYWRVCHSAV 717 >gb|ONK64366.1| uncharacterized protein A4U43_C07F25060 [Asparagus officinalis] Length = 492 Score = 50.4 bits (119), Expect(2) = 1e-10 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T+VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 421 TIVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 460 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 464 RQALPWMQISCWEYWRVCHSAV 485 >ref|XP_020272580.1| uncharacterized protein LOC109847759 isoform X1 [Asparagus officinalis] Length = 741 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 670 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 709 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 713 RQALPWMQISCWEYWRVCHSAV 734 >ref|XP_020272582.1| uncharacterized protein LOC109847759 isoform X3 [Asparagus officinalis] Length = 678 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 607 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 646 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 650 RQALPWMQISCWEYWRVCHSAV 671 >ref|XP_020272583.1| uncharacterized protein LOC109847759 isoform X4 [Asparagus officinalis] Length = 660 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 589 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 628 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 632 RQALPWMQISCWEYWRVCHSAV 653 >ref|XP_020272584.1| uncharacterized protein LOC109847759 isoform X5 [Asparagus officinalis] Length = 631 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 560 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 599 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 603 RQALPWMQISCWEYWRVCHSAV 624 >ref|XP_020272585.1| uncharacterized protein LOC109847759 isoform X6 [Asparagus officinalis] Length = 630 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 559 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 598 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 602 RQALPWMQISCWEYWRVCHSAV 623 >ref|XP_020272586.1| uncharacterized protein LOC109847759 isoform X7 [Asparagus officinalis] Length = 576 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 505 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 544 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 548 RQALPWMQISCWEYWRVCHSAV 569 >ref|XP_020272587.1| phosphatidylinositol N-acetylglucosaminyltransferase subunit Q-like isoform X8 [Asparagus officinalis] Length = 509 Score = 49.3 bits (116), Expect(2) = 3e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQIV+PS +NL +RL+ IGGPS + +LSGQR ++LQ Sbjct: 438 TAVQIVSPSYRNLFQRLKPLIGGPSVFGILSGQRIPASLQ 477 Score = 45.4 bits (106), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 + ALPWMQISC EYWR+CHS+V Sbjct: 481 RQALPWMQISCWEYWRVCHSAV 502 >ref|XP_020262950.1| uncharacterized protein LOC109838930 isoform X5 [Asparagus officinalis] ref|XP_020262951.1| uncharacterized protein LOC109838930 isoform X5 [Asparagus officinalis] Length = 706 Score = 47.0 bits (110), Expect(2) = 4e-09 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -2 Query: 1162 TLVQIVAPSCKNLLERLRLSIGGPSAYSVLSGQRTHSTLQ 1043 T VQI+APS +NL +RLR I GPS + +LSGQR ++LQ Sbjct: 635 TPVQIMAPSYRNLFQRLRSFIDGPSLHGILSGQRISASLQ 674 Score = 43.9 bits (102), Expect(2) = 4e-09 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 1032 KPALPWMQISCAEYWRLCHSSV 967 +PALPWMQIS EYWRLCH S+ Sbjct: 678 RPALPWMQISYWEYWRLCHLSI 699