BLASTX nr result
ID: Ophiopogon23_contig00002067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00002067 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77066.1| uncharacterized protein A4U43_C02F2760 [Asparagus... 59 2e-07 ref|XP_020250149.1| homeobox-leucine zipper protein HAT5-like [A... 60 4e-07 >gb|ONK77066.1| uncharacterized protein A4U43_C02F2760 [Asparagus officinalis] Length = 163 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 108 MAGRRVYGGSEMAVLLQNEGISAETFDALLSSTSSH 1 M GRRVYGGSEM VLLQNEGIS+E F AL+ S+SSH Sbjct: 1 MTGRRVYGGSEMGVLLQNEGISSEAFQALIFSSSSH 36 >ref|XP_020250149.1| homeobox-leucine zipper protein HAT5-like [Asparagus officinalis] gb|ONK80851.1| uncharacterized protein A4U43_C01F22480 [Asparagus officinalis] Length = 293 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/37 (83%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -1 Query: 108 MAGRRVYGGSEMAVLLQN-EGISAETFDALLSSTSSH 1 MAGRRVYGGSEMAVLLQN EGIS+E F AL+SS+SSH Sbjct: 1 MAGRRVYGGSEMAVLLQNEEGISSEAFQALISSSSSH 37