BLASTX nr result
ID: Ophiopogon23_contig00000831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00000831 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAM36311.1| hypothetical protein [Thermobia domestica] 55 8e-08 >emb|CAM36311.1| hypothetical protein [Thermobia domestica] Length = 53 Score = 55.5 bits (132), Expect = 8e-08 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = -1 Query: 282 LILR*SYLRDNSVILMGSSYLY*SLRPRC*IKIMVWCSL*TIKSVRLLKSYMI 124 +I+R SYLRDNSVI +SY LRPRC IKI+ C +SVR LKSYMI Sbjct: 1 MIVRLSYLRDNSVIFFENSYRQERLRPRCWIKILSRCRSLVYRSVRPLKSYMI 53