BLASTX nr result
ID: Ophiopogon23_contig00000213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00000213 (738 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008780172.1| PREDICTED: cyclin-dependent protein kinase i... 62 2e-08 gb|ONK63965.1| uncharacterized protein A4U43_C07F20730 [Asparagu... 59 2e-07 ref|XP_008803458.1| PREDICTED: cyclin-dependent protein kinase i... 56 2e-06 >ref|XP_008780172.1| PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Phoenix dactylifera] Length = 119 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +3 Query: 423 CRTPISKESKLPSIASTCPPAPKKMXXXXXXXXXXXXVSEFDLFAVSAQEMERLFRRRDD 602 CRTP SKESKLPS +CPPAP+K V E ++ V A+E+ERLFRRRD+ Sbjct: 41 CRTPTSKESKLPSTPRSCPPAPRK--PRRVVSCKRRLVEEVEVIMVGAEELERLFRRRDE 98 >gb|ONK63965.1| uncharacterized protein A4U43_C07F20730 [Asparagus officinalis] Length = 122 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = +3 Query: 423 CRTPISKESKLPSIASTCPPAPKKMXXXXXXXXXXXXVSEFDLFAVSAQEMERLFRRR 596 CRTP S ESKL S+ TCPPAPKK +SEFD VS++E+E+LF RR Sbjct: 56 CRTPTSNESKLSSVPLTCPPAPKK--ARSYNSGCRRRLSEFDFLEVSSEELEKLFSRR 111 >ref|XP_008803458.1| PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Phoenix dactylifera] ref|XP_008803459.1| PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Phoenix dactylifera] Length = 125 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = +3 Query: 423 CRTPISKESKLPSIASTCPPAPKKMXXXXXXXXXXXXVSEFDLFAVSAQEMERLFRRRD 599 CRTP S+ESK+P + S+CPPAPKK +SE +LF +E+E FR+RD Sbjct: 44 CRTPTSEESKIPPVPSSCPPAPKK---PRQVLLCKRRLSELELFGAQVEEIELWFRQRD 99