BLASTX nr result
ID: Ophiopogon23_contig00000162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00000162 (797 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276227.1| ATP synthase delta chain, chloroplastic [Asp... 71 4e-11 >ref|XP_020276227.1| ATP synthase delta chain, chloroplastic [Asparagus officinalis] gb|ONK62983.1| uncharacterized protein A4U43_C07F10180 [Asparagus officinalis] Length = 210 Score = 71.2 bits (173), Expect = 4e-11 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -1 Query: 179 MNILNHSIPSSNGQPLLPPKSSATQDATQHLSMAQSLQGAHTVSPFRPNSSKKGS 15 M+ILNHSIP+ NGQPLLPPKSSA QDA+QHLSMA+S Q AH + P+ S + S Sbjct: 1 MSILNHSIPT-NGQPLLPPKSSAAQDASQHLSMARSSQAAHWMKSSEPDPSARSS 54