BLASTX nr result
ID: Ophiopogon22_contig00040469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00040469 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267610.1| protein MEI2-like 1 [Asparagus officinalis] ... 62 2e-08 gb|PKA64192.1| Protein terminal ear1 like [Apostasia shenzhenica] 53 8e-06 >ref|XP_020267610.1| protein MEI2-like 1 [Asparagus officinalis] gb|ONK68527.1| uncharacterized protein A4U43_C05F12860 [Asparagus officinalis] Length = 302 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +3 Query: 54 KGLAELLRHFRCSTFICENGDYRPTHFVPSRNGLRLTSQRCIGRHIFPRAPAP 212 +GL LLR F S F+CE DYRP HF PSR+GLR T +R +G HI R +P Sbjct: 244 QGLPALLRRFATSVFMCEKADYRPLHFRPSRDGLRWTKRRYLGTHIQSRFLSP 296 >gb|PKA64192.1| Protein terminal ear1 like [Apostasia shenzhenica] Length = 152 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 48 KDKGLAELLRHFRCSTFICENGDYRPTHFVPSRNGLRLTSQRCIG 182 K +GLA LLRHFR S F C + DY P F PSR+G+R S + IG Sbjct: 100 KIQGLARLLRHFRSSIFTCSSADYLPVFFKPSRDGVRRPSGQLIG 144