BLASTX nr result
ID: Ophiopogon22_contig00040444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00040444 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC53702.1| hypothetical protein RIR_3484400 [Rhizophagus ir... 76 8e-15 gb|PKK67592.1| hypothetical protein RhiirC2_751513 [Rhizophagus ... 74 9e-13 >dbj|GBC53702.1| hypothetical protein RIR_3484400 [Rhizophagus irregularis DAOM 181602] Length = 134 Score = 76.3 bits (186), Expect = 8e-15 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +3 Query: 3 KKDMVNVELWKEHSVTLGKLAVENRINKYEILTTGIRAVTGAVVTEFP 146 KKD VN++LW+ +S LGK+A+ENR+NK E+LTTGIRA TGAV TEFP Sbjct: 83 KKDQVNIDLWQTYSTKLGKMAIENRVNKCEVLTTGIRAATGAVATEFP 130 >gb|PKK67592.1| hypothetical protein RhiirC2_751513 [Rhizophagus irregularis] Length = 330 Score = 74.3 bits (181), Expect = 9e-13 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +3 Query: 297 LPEDIKKWSPDHVKKFLESRMKDLDFNETDIKKIRDQDLTGRAF 428 LP ++K WSPDHVKKFLESRM + DFNE D+KKIR+++LTGRAF Sbjct: 223 LPSNVKMWSPDHVKKFLESRMNNSDFNEIDVKKIRNKELTGRAF 266