BLASTX nr result
ID: Ophiopogon22_contig00040255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00040255 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU37842.1| hypothetical protein AG1IA_08128 [Rhizoctonia sol... 83 4e-18 >gb|ELU37842.1| hypothetical protein AG1IA_08128 [Rhizoctonia solani AG-1 IA] Length = 93 Score = 83.2 bits (204), Expect = 4e-18 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 51 HPELCLHRCAGDQRLLEIPSSCCRVSGNNPAITYFDD 161 +PELCLHRCAGDQRLLEIPSSCCRVSGNNPAITYFDD Sbjct: 57 NPELCLHRCAGDQRLLEIPSSCCRVSGNNPAITYFDD 93