BLASTX nr result
ID: Ophiopogon22_contig00040198
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00040198 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA37512.1| hypothetical protein AQUCO_03000232v1 [Aquilegia ... 63 8e-10 gb|PIN22991.1| hypothetical protein CDL12_04301 [Handroanthus im... 58 7e-08 ref|XP_004305109.1| PREDICTED: uncharacterized protein LOC101307... 56 5e-07 gb|ONI03808.1| hypothetical protein PRUPE_6G283600 [Prunus persica] 55 1e-06 gb|KZM83700.1| hypothetical protein DCAR_028878 [Daucus carota s... 53 4e-06 gb|EXB53548.1| hypothetical protein L484_007919 [Morus notabilis... 53 5e-06 gb|PRQ42821.1| hypothetical protein RchiOBHm_Chr3g0461821 [Rosa ... 53 7e-06 >gb|PIA37512.1| hypothetical protein AQUCO_03000232v1 [Aquilegia coerulea] Length = 94 Score = 62.8 bits (151), Expect = 8e-10 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 8/81 (9%) Frame = -2 Query: 490 WWIKKS-FLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYRDIQVMWEM 314 WW K+ FLL ++ LV S++ R+ K G ++GLV L K+++ CS Y DIQVMWEM Sbjct: 7 WWCSKNTFLLSSKRLVFSITSRLTHK----AKGSKHGLVNLSKDMESCSEYADIQVMWEM 62 Query: 313 IHASKASTD-------EHNKK 272 +H+S ++ HNK+ Sbjct: 63 LHSSACPSNTKYNINRNHNKR 83 >gb|PIN22991.1| hypothetical protein CDL12_04301 [Handroanthus impetiginosus] Length = 94 Score = 57.8 bits (138), Expect = 7e-08 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 4/73 (5%) Frame = -2 Query: 505 MERLIWW----IKKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYR 338 M+R +W IK FLL+ +H+++S + ++ R R R LV L K+I+ C GY Sbjct: 3 MKRRKFWLSSIIKNLFLLQKKHIIASANSQL-RHRTKE---RRRELVNLYKDIEACGGYE 58 Query: 337 DIQVMWEMIHASK 299 DIQVMWEMIH+S+ Sbjct: 59 DIQVMWEMIHSSR 71 >ref|XP_004305109.1| PREDICTED: uncharacterized protein LOC101307233 [Fragaria vesca subsp. vesca] Length = 109 Score = 55.8 bits (133), Expect = 5e-07 Identities = 28/69 (40%), Positives = 43/69 (62%) Frame = -2 Query: 484 IKKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYRDIQVMWEMIHA 305 +K+SFL+ + + L+ R K+ NG NGLV L K+I+ C Y DI+VMWEMIH+ Sbjct: 23 LKQSFLIPTKCFLIKLTSRSRHKQKGNG----NGLVSLYKDIETCGEYADIKVMWEMIHS 78 Query: 304 SKASTDEHN 278 ++D+ + Sbjct: 79 CPQNSDDRH 87 >gb|ONI03808.1| hypothetical protein PRUPE_6G283600 [Prunus persica] Length = 103 Score = 54.7 bits (130), Expect = 1e-06 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%) Frame = -2 Query: 511 RSMERLIWW-----IKKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCS 347 RS +++ W K+SFLL + + L+ R K NG +GLV L K+++ C Sbjct: 9 RSHVKMMGWRTWMCFKRSFLLPTKCFLLKLTSRSRNKAKGNG----HGLVNLYKDMESCG 64 Query: 346 GYRDIQVMWEMIHASKASTDEHN 278 Y DI+VMWE+IH+S T+ N Sbjct: 65 EYEDIRVMWEIIHSSPQKTNSSN 87 >gb|KZM83700.1| hypothetical protein DCAR_028878 [Daucus carota subsp. sativus] Length = 90 Score = 53.1 bits (126), Expect = 4e-06 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 4/82 (4%) Frame = -2 Query: 505 MERLIWWI----KKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYR 338 MER W+ KKSFL ++ ++ + R+ K G G+V L K+ + C+GY Sbjct: 1 MERWKKWLSFNFKKSFLRPSKAILLKVISRLRHKSKEKG----TGMVSLYKDKEACAGYE 56 Query: 337 DIQVMWEMIHASKASTDEHNKK 272 DIQVMWEM+H+S + +K Sbjct: 57 DIQVMWEMVHSSIYTNSPQTRK 78 >gb|EXB53548.1| hypothetical protein L484_007919 [Morus notabilis] gb|EXC43426.1| hypothetical protein L484_000332 [Morus notabilis] Length = 105 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/72 (34%), Positives = 42/72 (58%) Frame = -2 Query: 487 WIKKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYRDIQVMWEMIH 308 W KK F++ + ++ L+ RK NG +GLV L K+++ C Y DI+VMWE+IH Sbjct: 23 WFKKKFIVPTKSVLGKLTSTSRRKLKGNG----HGLVSLYKDMESCGEYADIRVMWEIIH 78 Query: 307 ASKASTDEHNKK 272 + T + +++ Sbjct: 79 SCPQRTPKRSER 90 >gb|PRQ42821.1| hypothetical protein RchiOBHm_Chr3g0461821 [Rosa chinensis] Length = 105 Score = 52.8 bits (125), Expect = 7e-06 Identities = 27/71 (38%), Positives = 43/71 (60%) Frame = -2 Query: 484 IKKSFLLRARHLVSSLSLRIGRKRISNGGGERNGLVKLQKEIKKCSGYRDIQVMWEMIHA 305 +K+S L+ + + L+LR K+ NG NGLV L K+I+ C Y DI+VMWEMIH+ Sbjct: 23 LKQSCLIPTKCFLIKLTLRSRHKQKGNG----NGLVSLYKDIETCGEYADIKVMWEMIHS 78 Query: 304 SKASTDEHNKK 272 +++ ++ Sbjct: 79 CPQNSNNSTER 89