BLASTX nr result
ID: Ophiopogon22_contig00040121
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00040121 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021893785.1| chitin elicitor receptor kinase 1-like [Cari... 101 9e-25 gb|PKI54365.1| hypothetical protein CRG98_025251, partial [Punic... 97 2e-23 ref|XP_022771752.1| chitin elicitor receptor kinase 1-like isofo... 102 5e-23 gb|EOX93290.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1... 100 7e-23 gb|KZM91486.1| hypothetical protein DCAR_021149 [Daucus carota s... 100 8e-23 gb|POF22826.1| chitin elicitor receptor kinase 1 [Quercus suber] 95 8e-23 gb|KDP30783.1| hypothetical protein JCGZ_13726 [Jatropha curcas] 100 8e-23 gb|EEF37042.1| receptor protein kinase, putative [Ricinus communis] 102 1e-22 ref|XP_015578590.1| PREDICTED: chitin elicitor receptor kinase 1... 102 1e-22 ref|XP_022771751.1| lysM domain receptor-like kinase 3 isoform X... 102 1e-22 ref|XP_015578589.1| PREDICTED: chitin elicitor receptor kinase 1... 102 1e-22 gb|KJB42867.1| hypothetical protein B456_007G171300 [Gossypium r... 99 3e-22 gb|ERN10677.1| hypothetical protein AMTR_s00028p00239040 [Ambore... 100 3e-22 gb|ERM96975.1| hypothetical protein AMTR_s00074p00174510 [Ambore... 94 3e-22 gb|AIT39749.1| chitin elicitor receptor kinase 1 [Chrysanthemum ... 100 4e-22 ref|XP_011007198.1| PREDICTED: chitin elicitor receptor kinase 1... 100 5e-22 gb|AKK25222.1| Lyk 3 [Populus x canadensis] 100 5e-22 ref|XP_002301610.1| LysM domain-containing receptor-like kinase ... 100 5e-22 gb|PPR88604.1| hypothetical protein GOBAR_AA32079 [Gossypium bar... 100 5e-22 gb|KHG29637.1| Proline-rich receptor-like protein kinase PERK13 ... 100 5e-22 >ref|XP_021893785.1| chitin elicitor receptor kinase 1-like [Carica papaya] Length = 137 Score = 101 bits (251), Expect = 9e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+L+SGR Sbjct: 86 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLLSGR 137 >gb|PKI54365.1| hypothetical protein CRG98_025251, partial [Punica granatum] Length = 130 Score = 97.4 bits (241), Expect = 2e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTL S+TEDWD+GSFYEN ALV+LMSGR Sbjct: 79 QLAKACTQENPQLRPSMRSIVVALMTLCSTTEDWDVGSFYENHALVNLMSGR 130 >ref|XP_022771752.1| chitin elicitor receptor kinase 1-like isoform X2 [Durio zibethinus] Length = 404 Score = 102 bits (254), Expect = 5e-23 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 353 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 404 >gb|EOX93290.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] gb|EOX93291.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] Length = 297 Score = 100 bits (249), Expect = 7e-23 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYEN ALV+LMSGR Sbjct: 246 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENHALVNLMSGR 297 >gb|KZM91486.1| hypothetical protein DCAR_021149 [Daucus carota subsp. sativus] Length = 307 Score = 100 bits (249), Expect = 8e-23 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYEN ALV+LMSGR Sbjct: 256 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDIGSFYENHALVNLMSGR 307 >gb|POF22826.1| chitin elicitor receptor kinase 1 [Quercus suber] Length = 86 Score = 94.7 bits (234), Expect = 8e-23 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 +LAKACTQE PQLRPSMRSIVVALMTLSSSTEDWD+GSFYEN ALV LM+GR Sbjct: 35 KLAKACTQETPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENHALVHLMTGR 86 >gb|KDP30783.1| hypothetical protein JCGZ_13726 [Jatropha curcas] Length = 270 Score = 99.8 bits (247), Expect = 8e-23 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENP LRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 219 QLAKACTQENPLLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 270 >gb|EEF37042.1| receptor protein kinase, putative [Ricinus communis] Length = 603 Score = 102 bits (254), Expect = 1e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 552 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 603 >ref|XP_015578590.1| PREDICTED: chitin elicitor receptor kinase 1 isoform X2 [Ricinus communis] Length = 616 Score = 102 bits (254), Expect = 1e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 565 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 616 >ref|XP_022771751.1| lysM domain receptor-like kinase 3 isoform X1 [Durio zibethinus] Length = 621 Score = 102 bits (254), Expect = 1e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 570 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 621 >ref|XP_015578589.1| PREDICTED: chitin elicitor receptor kinase 1 isoform X1 [Ricinus communis] Length = 625 Score = 102 bits (254), Expect = 1e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 574 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 625 >gb|KJB42867.1| hypothetical protein B456_007G171300 [Gossypium raimondii] Length = 297 Score = 99.0 bits (245), Expect = 3e-22 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSS+TEDWD+G+FYENQA+V+LMSGR Sbjct: 246 QLAKACTQENPQLRPSMRSIVVALMTLSSTTEDWDVGTFYENQAVVNLMSGR 297 >gb|ERN10677.1| hypothetical protein AMTR_s00028p00239040 [Amborella trichopoda] Length = 373 Score = 100 bits (248), Expect = 3e-22 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GS YENQALV+LMSGR Sbjct: 322 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSLYENQALVNLMSGR 373 >gb|ERM96975.1| hypothetical protein AMTR_s00074p00174510 [Amborella trichopoda] Length = 123 Score = 94.4 bits (233), Expect = 3e-22 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMS 263 QLAKACTQENPQLRPSMRSIVVALMT SSSTEDWD+GSFYENQAL++LMS Sbjct: 73 QLAKACTQENPQLRPSMRSIVVALMTHSSSTEDWDVGSFYENQALLNLMS 122 >gb|AIT39749.1| chitin elicitor receptor kinase 1 [Chrysanthemum boreale] Length = 410 Score = 100 bits (248), Expect = 4e-22 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACT ENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQ LVSLMSGR Sbjct: 359 QLAKACTHENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQTLVSLMSGR 410 >ref|XP_011007198.1| PREDICTED: chitin elicitor receptor kinase 1-like isoform X3 [Populus euphratica] Length = 580 Score = 100 bits (250), Expect = 5e-22 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QL KACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 529 QLGKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 580 >gb|AKK25222.1| Lyk 3 [Populus x canadensis] Length = 581 Score = 100 bits (250), Expect = 5e-22 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QL KACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 530 QLGKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 581 >ref|XP_002301610.1| LysM domain-containing receptor-like kinase 4 family protein [Populus trichocarpa] gb|PNT51117.1| hypothetical protein POPTR_002G226600v3 [Populus trichocarpa] Length = 581 Score = 100 bits (250), Expect = 5e-22 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QL KACTQENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 530 QLGKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 581 >gb|PPR88604.1| hypothetical protein GOBAR_AA32079 [Gossypium barbadense] Length = 606 Score = 100 bits (250), Expect = 5e-22 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACT+ENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 555 QLAKACTKENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 606 >gb|KHG29637.1| Proline-rich receptor-like protein kinase PERK13 [Gossypium arboreum] Length = 608 Score = 100 bits (250), Expect = 5e-22 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = -1 Query: 412 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDMGSFYENQALVSLMSGR 257 QLAKACT+ENPQLRPSMRSIVVALMTLSSSTEDWD+GSFYENQALV+LMSGR Sbjct: 557 QLAKACTKENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR 608