BLASTX nr result
ID: Ophiopogon22_contig00039486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039486 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248224.1| B3 domain-containing protein Os01g0905400-li... 78 4e-14 >ref|XP_020248224.1| B3 domain-containing protein Os01g0905400-like [Asparagus officinalis] gb|ONK57191.1| uncharacterized protein A4U43_C10F17540 [Asparagus officinalis] Length = 639 Score = 78.2 bits (191), Expect = 4e-14 Identities = 46/117 (39%), Positives = 65/117 (55%), Gaps = 20/117 (17%) Frame = +2 Query: 50 DDSKDELETRIDASIDLHAAKGECNVLDADEVEVITKRSSLHKNNPELPSTTPLLNYNVD 229 +DSKDE+E + DA+I L A K +C L A++ EV +K SSLH+N E PS +P+LN + Sbjct: 424 EDSKDEVEVKSDATISLLAPKEDCKALGAEKEEVTSKGSSLHENGIEAPSCSPILNCKDN 483 Query: 230 SQGNLPPPCKGIINCDRSEGNL--------------------GNDADPSQATTVKRS 340 Q +LP +GIIN ++SEG L + DP +TTVK + Sbjct: 484 DQDDLPLLLEGIINDNQSEGKLELDDKKVSPCSKGEASEVVKAKEMDPIDSTTVKNT 540