BLASTX nr result
ID: Ophiopogon22_contig00039474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039474 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69625.1| uncharacterized protein A4U43_C05F24960 [Asparagu... 72 3e-12 >gb|ONK69625.1| uncharacterized protein A4U43_C05F24960 [Asparagus officinalis] Length = 268 Score = 72.4 bits (176), Expect = 3e-12 Identities = 50/112 (44%), Positives = 60/112 (53%), Gaps = 2/112 (1%) Frame = +3 Query: 120 KSQPVARKPM-NPLSHSCKPIVRTLLKPTKTRERSLKPASPSPVPRTHXXXXXXXXXXDK 296 K QP+ +KP+ P S S KP VRTL P +RERS P PSP P K Sbjct: 51 KRQPLTKKPLEKPPSPSRKP-VRTLSTPITSRERS--PRVPSPTPSPVPRPQRSNSLISK 107 Query: 297 GPKPARGAKTGSFTRLKSLEKRKAVAVS-SALVDTSSASDSEASVIKKTELE 449 TG++TR KSL+KRK V S SA V+ SS SDSE +V KK + E Sbjct: 108 STSLINKTSTGAYTRSKSLDKRKVVVASPSAFVEASSVSDSEVAVAKKAQQE 159