BLASTX nr result
ID: Ophiopogon22_contig00039255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039255 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA51593.1| hypothetical protein AQUCO_01100444v1 [Aquilegia ... 69 4e-13 ref|XP_008342934.1| PREDICTED: organic cation/carnitine transpor... 66 4e-11 gb|OAY69210.1| Organic cation/carnitine transporter 7 [Ananas co... 69 4e-11 gb|EOY26205.1| Major facilitator superfamily protein isoform 1 [... 69 6e-11 ref|XP_017979372.1| PREDICTED: organic cation/carnitine transpor... 68 1e-10 gb|OMO83268.1| General substrate transporter [Corchorus capsularis] 68 1e-10 ref|XP_021297263.1| organic cation/carnitine transporter 7 [Herr... 68 1e-10 ref|XP_007023584.2| PREDICTED: organic cation/carnitine transpor... 68 1e-10 gb|PIA51588.1| hypothetical protein AQUCO_01100445v1 [Aquilegia ... 67 2e-10 gb|EOY26206.1| Major facilitator superfamily protein isoform 2, ... 67 2e-10 gb|PIA51591.1| hypothetical protein AQUCO_01100445v1 [Aquilegia ... 67 2e-10 gb|PIA51589.1| hypothetical protein AQUCO_01100445v1 [Aquilegia ... 67 2e-10 ref|XP_008228025.1| PREDICTED: organic cation/carnitine transpor... 67 4e-10 ref|XP_007215272.1| organic cation/carnitine transporter 7 [Prun... 67 4e-10 ref|XP_020080192.1| organic cation/carnitine transporter 7-like ... 66 4e-10 ref|XP_020080186.1| organic cation/carnitine transporter 7-like ... 66 5e-10 ref|XP_020080178.1| organic cation/carnitine transporter 7-like ... 66 5e-10 ref|XP_020080173.1| organic cation/carnitine transporter 7-like ... 66 5e-10 ref|XP_011467508.1| PREDICTED: organic cation/carnitine transpor... 66 5e-10 dbj|GAY58174.1| hypothetical protein CUMW_185090 [Citrus unshiu] 66 7e-10 >gb|PIA51593.1| hypothetical protein AQUCO_01100444v1 [Aquilegia coerulea] Length = 66 Score = 69.3 bits (168), Expect = 4e-13 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QTR 251 VGLV GC QTAA+LLFEL+I SG+AV FFPFETK R LSDS+ + Q + Sbjct: 14 VGLVHGCHQTAAILLFELIIFFSGVAVLFFPFETKGRVLSDSVSEIKQNK 63 >ref|XP_008342934.1| PREDICTED: organic cation/carnitine transporter 7-like [Malus domestica] Length = 141 Score = 66.2 bits (160), Expect = 4e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSI 272 VGLV GC QTA++LLFE+VI LSG+ V FPFETK RELSDS+ Sbjct: 88 VGLVHGCHQTASILLFEIVIFLSGVCVLLFPFETKGRELSDSL 130 >gb|OAY69210.1| Organic cation/carnitine transporter 7 [Ananas comosus] Length = 491 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLVE CRQ A+LLFE+V++L+G+ F FPFETKCRELSDS+ S Sbjct: 445 VGLVENCRQMEAILLFEVVMLLAGLGAFLFPFETKCRELSDSLNS 489 >gb|EOY26205.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gb|EOY26207.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gb|EOY26208.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 496 Score = 68.9 bits (167), Expect = 6e-11 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTAA+LLFE+VI +SGI V FFP ETK R+LSDSI S QT Sbjct: 444 VGLVHGCHQTAAILLFEIVIFVSGICVLFFPLETKGRDLSDSISSSKQT 492 >ref|XP_017979372.1| PREDICTED: organic cation/carnitine transporter 7 isoform X2 [Theobroma cacao] Length = 464 Score = 68.2 bits (165), Expect = 1e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTAA++LFE+VI +SGI V FFP ETK R+LSDSI S QT Sbjct: 412 VGLVHGCHQTAAIMLFEIVIFVSGICVLFFPLETKGRDLSDSISSSKQT 460 >gb|OMO83268.1| General substrate transporter [Corchorus capsularis] Length = 481 Score = 68.2 bits (165), Expect = 1e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTAA++LFE+VI +SGI V FFP ETK R+LSDSI S QT Sbjct: 427 VGLVHGCHQTAAIILFEIVIFVSGICVLFFPLETKGRDLSDSISSSKQT 475 >ref|XP_021297263.1| organic cation/carnitine transporter 7 [Herrania umbratica] Length = 496 Score = 68.2 bits (165), Expect = 1e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTAA++LFE+VI +SGI V FFP ETK R+LSDSI S QT Sbjct: 444 VGLVHGCHQTAAIMLFEIVIFVSGICVLFFPLETKGRDLSDSISSSKQT 492 >ref|XP_007023584.2| PREDICTED: organic cation/carnitine transporter 7 isoform X1 [Theobroma cacao] ref|XP_017979370.1| PREDICTED: organic cation/carnitine transporter 7 isoform X1 [Theobroma cacao] ref|XP_007023585.2| PREDICTED: organic cation/carnitine transporter 7 isoform X1 [Theobroma cacao] Length = 496 Score = 68.2 bits (165), Expect = 1e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTAA++LFE+VI +SGI V FFP ETK R+LSDSI S QT Sbjct: 444 VGLVHGCHQTAAIMLFEIVIFVSGICVLFFPLETKGRDLSDSISSSKQT 492 >gb|PIA51588.1| hypothetical protein AQUCO_01100445v1 [Aquilegia coerulea] gb|PIA51590.1| hypothetical protein AQUCO_01100445v1 [Aquilegia coerulea] Length = 348 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTA++LLFE+VI SGIAV FFPFETK ELSDS+ + Q+ Sbjct: 297 VGLVHGCHQTASILLFEIVIFFSGIAVLFFPFETKGCELSDSVSEIKQS 345 >gb|EOY26206.1| Major facilitator superfamily protein isoform 2, partial [Theobroma cacao] Length = 488 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLV GC QTAA+LLFE+VI +SGI V FFP ETK R+LSDSI S Sbjct: 444 VGLVHGCHQTAAILLFEIVIFVSGICVLFFPLETKGRDLSDSISS 488 >gb|PIA51591.1| hypothetical protein AQUCO_01100445v1 [Aquilegia coerulea] Length = 497 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTA++LLFE+VI SGIAV FFPFETK ELSDS+ + Q+ Sbjct: 446 VGLVHGCHQTASILLFEIVIFFSGIAVLFFPFETKGCELSDSVSEIKQS 494 >gb|PIA51589.1| hypothetical protein AQUCO_01100445v1 [Aquilegia coerulea] Length = 512 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRSL*QT 254 VGLV GC QTA++LLFE+VI SGIAV FFPFETK ELSDS+ + Q+ Sbjct: 461 VGLVHGCHQTASILLFEIVIFFSGIAVLFFPFETKGCELSDSVSEIKQS 509 >ref|XP_008228025.1| PREDICTED: organic cation/carnitine transporter 7 [Prunus mume] Length = 495 Score = 66.6 bits (161), Expect = 4e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLV GC QTA++LLFE+VI LSG+ V FPFETK RELSD++ S Sbjct: 444 VGLVHGCHQTASILLFEIVIFLSGVCVLLFPFETKGRELSDTVSS 488 >ref|XP_007215272.1| organic cation/carnitine transporter 7 [Prunus persica] ref|XP_020416556.1| organic cation/carnitine transporter 7 [Prunus persica] gb|ONI15128.1| hypothetical protein PRUPE_3G027200 [Prunus persica] gb|ONI15129.1| hypothetical protein PRUPE_3G027200 [Prunus persica] Length = 495 Score = 66.6 bits (161), Expect = 4e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLV GC QTA++LLFE+VI LSG+ V FPFETK RELSD++ S Sbjct: 444 VGLVHGCHQTASILLFEIVIFLSGVCVLLFPFETKGRELSDTVSS 488 >ref|XP_020080192.1| organic cation/carnitine transporter 7-like isoform X4 [Ananas comosus] ref|XP_020080197.1| organic cation/carnitine transporter 7-like isoform X4 [Ananas comosus] Length = 342 Score = 66.2 bits (160), Expect = 4e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLVE CRQ A+LLFE+V++L+G+ F FPFETKC ELSDS+ S Sbjct: 296 VGLVENCRQMEAILLFEVVMLLAGLGAFLFPFETKCCELSDSLNS 340 >ref|XP_020080186.1| organic cation/carnitine transporter 7-like isoform X3 [Ananas comosus] Length = 403 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLVE CRQ A+LLFE+V++L+G+ F FPFETKC ELSDS+ S Sbjct: 357 VGLVENCRQMEAILLFEVVMLLAGLGAFLFPFETKCCELSDSLNS 401 >ref|XP_020080178.1| organic cation/carnitine transporter 7-like isoform X2 [Ananas comosus] Length = 406 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLVE CRQ A+LLFE+V++L+G+ F FPFETKC ELSDS+ S Sbjct: 360 VGLVENCRQMEAILLFEVVMLLAGLGAFLFPFETKCCELSDSLNS 404 >ref|XP_020080173.1| organic cation/carnitine transporter 7-like isoform X1 [Ananas comosus] Length = 491 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 VGLVE CRQ A+LLFE+V++L+G+ F FPFETKC ELSDS+ S Sbjct: 445 VGLVENCRQMEAILLFEVVMLLAGLGAFLFPFETKCCELSDSLNS 489 >ref|XP_011467508.1| PREDICTED: organic cation/carnitine transporter 7 [Fragaria vesca subsp. vesca] Length = 495 Score = 66.2 bits (160), Expect = 5e-10 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 V LV GC QTA++LLFE+VI+LSGI V FPFETK RELSDS+ S Sbjct: 442 VALVHGCHQTASILLFEVVILLSGICVMLFPFETKGRELSDSVSS 486 >dbj|GAY58174.1| hypothetical protein CUMW_185090 [Citrus unshiu] Length = 388 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 400 VGLVEGCRQTAALLLFELVIVLSGIAVFFFPFETKCRELSDSIRS 266 V LV GC QTAAL+LFELVI+LSGI+V FFPFET R LSDS+ S Sbjct: 338 VALVHGCHQTAALILFELVILLSGISVLFFPFETMGRGLSDSLSS 382