BLASTX nr result
ID: Ophiopogon22_contig00039241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039241 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272340.1| cellulose synthase A catalytic subunit 7 [UD... 82 2e-15 ref|XP_019704283.1| PREDICTED: cellulose synthase A catalytic su... 67 6e-10 ref|XP_010910021.2| PREDICTED: cellulose synthase A catalytic su... 67 6e-10 ref|XP_020102829.1| probable cellulose synthase A catalytic subu... 66 8e-10 ref|XP_020102828.1| probable cellulose synthase A catalytic subu... 66 8e-10 ref|XP_020102827.1| probable cellulose synthase A catalytic subu... 66 8e-10 gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea] 56 3e-06 >ref|XP_020272340.1| cellulose synthase A catalytic subunit 7 [UDP-forming]-like isoform X1 [Asparagus officinalis] gb|ONK63022.1| uncharacterized protein A4U43_C07F10570 [Asparagus officinalis] Length = 1042 Score = 82.0 bits (201), Expect = 2e-15 Identities = 36/58 (62%), Positives = 41/58 (70%) Frame = +3 Query: 246 MDKDLEKEPQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCN 419 MD DL+KE Q CG+CRS LELHCDK L V CN CG V TCYE IL ++SC KC+ Sbjct: 1 MDNDLQKESQACGICRSSLELHCDKNLLVPCNECGCAVCSTCYEFILTVGNQSCPKCS 58 >ref|XP_019704283.1| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like isoform X2 [Elaeis guineensis] Length = 958 Score = 66.6 bits (161), Expect = 6e-10 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 246 MDKDLEKE--PQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCN 419 M+K + K+ Q C +CRSWL H D R +ACN CGYPV RTCYE + ++SC KC+ Sbjct: 1 MEKPIRKKIHDQFCEVCRSWLGSHQDGRPPLACNECGYPVCRTCYEFMWKVGNQSCPKCS 60 Query: 420 SIY 428 + Y Sbjct: 61 NTY 63 >ref|XP_010910021.2| PREDICTED: cellulose synthase A catalytic subunit 7 [UDP-forming]-like isoform X1 [Elaeis guineensis] Length = 1075 Score = 66.6 bits (161), Expect = 6e-10 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 246 MDKDLEKE--PQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCN 419 M+K + K+ Q C +CRSWL H D R +ACN CGYPV RTCYE + ++SC KC+ Sbjct: 1 MEKPIRKKIHDQFCEVCRSWLGSHQDGRPPLACNECGYPVCRTCYEFMWKVGNQSCPKCS 60 Query: 420 SIY 428 + Y Sbjct: 61 NTY 63 >ref|XP_020102829.1| probable cellulose synthase A catalytic subunit 8 [UDP-forming] isoform X3 [Ananas comosus] Length = 801 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = +3 Query: 261 EKEPQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCNSIY 428 E + QVC +C+SWL L+ ++L VAC CG+PV CY +IL A S+ C KCNS+Y Sbjct: 8 EVQDQVCLVCQSWLGLYQGEKLLVACEGCGFPVCGACYVVILKAGSQQCPKCNSLY 63 >ref|XP_020102828.1| probable cellulose synthase A catalytic subunit 8 [UDP-forming] isoform X2 [Ananas comosus] Length = 1022 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = +3 Query: 261 EKEPQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCNSIY 428 E + QVC +C+SWL L+ ++L VAC CG+PV CY +IL A S+ C KCNS+Y Sbjct: 8 EVQDQVCLVCQSWLGLYQGEKLLVACEGCGFPVCGACYVVILKAGSQQCPKCNSLY 63 >ref|XP_020102827.1| probable cellulose synthase A catalytic subunit 8 [UDP-forming] isoform X1 [Ananas comosus] Length = 1043 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/56 (51%), Positives = 39/56 (69%) Frame = +3 Query: 261 EKEPQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCNSIY 428 E + QVC +C+SWL L+ ++L VAC CG+PV CY +IL A S+ C KCNS+Y Sbjct: 8 EVQDQVCLVCQSWLGLYQGEKLLVACEGCGFPVCGACYVVILKAGSQQCPKCNSLY 63 >gb|EPS71230.1| hypothetical protein M569_03522 [Genlisea aurea] Length = 1086 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = +3 Query: 261 EKEPQVCGLCRSWLELHCDKRLFVACNVCGYPV*RTCYELILIAESRSCSKCNSIY 428 E Q C +C LE+ D+ LFVACN C +PV RTCYE S+ C +C + Y Sbjct: 35 ELSDQTCQICGDELEITADRELFVACNECAFPVCRTCYEYERREGSQCCPQCRTRY 90