BLASTX nr result
ID: Ophiopogon22_contig00039160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039160 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020083608.1| cytochrome P450 86A8-like [Ananas comosus] 87 4e-17 gb|OAY63577.1| Cytochrome P450 86A22 [Ananas comosus] 87 4e-17 ref|XP_020090344.1| cytochrome P450 86A2-like [Ananas comosus] 84 3e-16 ref|XP_013447052.1| cytochrome P450 family 94 protein [Medicago ... 84 3e-16 ref|XP_010907215.1| PREDICTED: cytochrome P450 86A8-like [Elaeis... 84 3e-16 ref|XP_011092582.1| cytochrome P450 86A8-like [Sesamum indicum] 84 4e-16 ref|XP_010918585.1| PREDICTED: cytochrome P450 86A8-like [Elaeis... 84 4e-16 ref|XP_008804035.1| PREDICTED: cytochrome P450 86A8-like [Phoeni... 84 4e-16 ref|XP_020094214.1| cytochrome P450 86A2-like [Ananas comosus] 84 6e-16 gb|OAY75723.1| Cytochrome P450 86A22 [Ananas comosus] 84 6e-16 gb|KZV14531.1| hypothetical protein F511_42766 [Dorcoceras hygro... 84 6e-16 ref|XP_010255320.1| PREDICTED: cytochrome P450 86A8 [Nelumbo nuc... 84 6e-16 ref|XP_016466023.1| PREDICTED: cytochrome P450 86A8-like, partia... 82 8e-16 emb|CBI40391.3| unnamed protein product, partial [Vitis vinifera] 83 8e-16 ref|XP_004143898.1| PREDICTED: cytochrome P450 86A7 [Cucumis sat... 83 8e-16 ref|XP_004510774.1| PREDICTED: cytochrome P450 86A8 [Cicer ariet... 83 8e-16 gb|OMP00415.1| Cytochrome P450 [Corchorus olitorius] 82 8e-16 gb|OWM64249.1| hypothetical protein CDL15_Pgr018821 [Punica gran... 83 8e-16 emb|CAN80156.1| hypothetical protein VITISV_023926 [Vitis vinifera] 83 8e-16 ref|XP_019190414.1| PREDICTED: cytochrome P450 86A8-like [Ipomoe... 83 8e-16 >ref|XP_020083608.1| cytochrome P450 86A8-like [Ananas comosus] Length = 606 Score = 87.0 bits (214), Expect = 4e-17 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y+ WF+ L LR GPRVWP++GSLPGLV NAERMH+WIA NL+ AGGTYQT Sbjct: 66 YMAWFWRLARGLRGGPRVWPVVGSLPGLVQNAERMHEWIAGNLRGAGGTYQT 117 >gb|OAY63577.1| Cytochrome P450 86A22 [Ananas comosus] Length = 608 Score = 87.0 bits (214), Expect = 4e-17 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y+ WF+ L LR GPRVWP++GSLPGLV NAERMH+WIA NL+ AGGTYQT Sbjct: 67 YMAWFWRLARGLRGGPRVWPVVGSLPGLVQNAERMHEWIAGNLRGAGGTYQT 118 >ref|XP_020090344.1| cytochrome P450 86A2-like [Ananas comosus] Length = 345 Score = 83.6 bits (205), Expect = 3e-16 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y WF L LR GPRVWPL+GSLPGLV NAERMH+WIA NLQA GGTYQT Sbjct: 17 YAVWFLRLRRGLR-GPRVWPLVGSLPGLVRNAERMHEWIAGNLQATGGTYQT 67 >ref|XP_013447052.1| cytochrome P450 family 94 protein [Medicago truncatula] gb|KEH21079.1| cytochrome P450 family 94 protein [Medicago truncatula] Length = 517 Score = 84.3 bits (207), Expect = 3e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SL+ GPRVWPLLGSLPGL+H+A RMHDWIA NL+A GGTYQT Sbjct: 16 YLIWFSFITRSLK-GPRVWPLLGSLPGLIHHANRMHDWIADNLRACGGTYQT 66 >ref|XP_010907215.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis] Length = 540 Score = 84.3 bits (207), Expect = 3e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y+ WF L LR GPRVWPLLGSLPGL+ N ERMHDWIA NL+A GGTYQT Sbjct: 16 YVIWFSRLAAGLR-GPRVWPLLGSLPGLIQNGERMHDWIAENLRATGGTYQT 66 >ref|XP_011092582.1| cytochrome P450 86A8-like [Sesamum indicum] Length = 521 Score = 84.0 bits (206), Expect = 4e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SL+ GPRVWPLLGSLPGL+ NA+RMHDWIA NL+A GGTYQT Sbjct: 16 YLLWFTFISKSLK-GPRVWPLLGSLPGLIENADRMHDWIADNLRACGGTYQT 66 >ref|XP_010918585.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis] Length = 548 Score = 84.0 bits (206), Expect = 4e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y WF L LR GPRVWPLLGS+PGL+ NAERMHDWIA NL+A GGTYQT Sbjct: 16 YAMWFSRLATGLR-GPRVWPLLGSVPGLIQNAERMHDWIAENLRATGGTYQT 66 >ref|XP_008804035.1| PREDICTED: cytochrome P450 86A8-like [Phoenix dactylifera] Length = 548 Score = 84.0 bits (206), Expect = 4e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y WF L LR GPRVWPLLGS+PGL+ N ERMHDWIA NL+AAGGTYQT Sbjct: 16 YAMWFSRLASGLR-GPRVWPLLGSVPGLIQNGERMHDWIAENLRAAGGTYQT 66 >ref|XP_020094214.1| cytochrome P450 86A2-like [Ananas comosus] Length = 529 Score = 83.6 bits (205), Expect = 6e-16 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y WF L LR GPRVWPL+GSLPGLV NAERMH+WIA NLQA GGTYQT Sbjct: 17 YAVWFLRLRRGLR-GPRVWPLVGSLPGLVRNAERMHEWIAGNLQATGGTYQT 67 >gb|OAY75723.1| Cytochrome P450 86A22 [Ananas comosus] Length = 529 Score = 83.6 bits (205), Expect = 6e-16 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 Y WF L LR GPRVWPL+GSLPGLV NAERMH+WIA NLQA GGTYQT Sbjct: 17 YAVWFLRLRRGLR-GPRVWPLVGSLPGLVRNAERMHEWIAGNLQATGGTYQT 67 >gb|KZV14531.1| hypothetical protein F511_42766 [Dorcoceras hygrometricum] Length = 550 Score = 83.6 bits (205), Expect = 6e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SL+ GPRVWPLLGSLPGL+ NAERMH+WIA NL+A GGTYQT Sbjct: 16 YLMWFTFISKSLK-GPRVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQT 66 >ref|XP_010255320.1| PREDICTED: cytochrome P450 86A8 [Nelumbo nucifera] Length = 561 Score = 83.6 bits (205), Expect = 6e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YLFWF + SL GPRVWPLLGSLPGL+ NA+RMH+WIA NL+A GGTYQT Sbjct: 16 YLFWFRFISRSLN-GPRVWPLLGSLPGLIENADRMHEWIAENLRACGGTYQT 66 >ref|XP_016466023.1| PREDICTED: cytochrome P450 86A8-like, partial [Nicotiana tabacum] Length = 307 Score = 82.0 bits (201), Expect = 8e-16 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SL+ GPRVWPLLGSLPGL+ N+ERMHDWI NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLK-GPRVWPLLGSLPGLIENSERMHDWIVDNLRACGGTYQT 66 >emb|CBI40391.3| unnamed protein product, partial [Vitis vinifera] Length = 524 Score = 83.2 bits (204), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SLR GPRVWPLLGSLPGL+ N+ERMH+WIA NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLR-GPRVWPLLGSLPGLIENSERMHEWIAENLRACGGTYQT 66 >ref|XP_004143898.1| PREDICTED: cytochrome P450 86A7 [Cucumis sativus] gb|KGN50086.1| hypothetical protein Csa_5G153010 [Cucumis sativus] Length = 524 Score = 83.2 bits (204), Expect = 8e-16 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF N+ SL GPRVWPLLGSLPGL+ N+ RMHDWI NLQ+ GGTYQT Sbjct: 16 YLIWFLNIKRSLN-GPRVWPLLGSLPGLIKNSHRMHDWIVENLQSTGGTYQT 66 >ref|XP_004510774.1| PREDICTED: cytochrome P450 86A8 [Cicer arietinum] Length = 539 Score = 83.2 bits (204), Expect = 8e-16 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SLR GPRVWPLLGSLPGL+ N ERMHDWI+ NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLR-GPRVWPLLGSLPGLIENCERMHDWISDNLRACGGTYQT 66 >gb|OMP00415.1| Cytochrome P450 [Corchorus olitorius] Length = 313 Score = 82.0 bits (201), Expect = 8e-16 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SLR GPRVWPLLGSLPGL+ N +RMHDWI+ NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLR-GPRVWPLLGSLPGLIENCDRMHDWISDNLRACGGTYQT 66 >gb|OWM64249.1| hypothetical protein CDL15_Pgr018821 [Punica granatum] gb|PKI40004.1| hypothetical protein CRG98_039667 [Punica granatum] Length = 547 Score = 83.2 bits (204), Expect = 8e-16 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SLR GPRVWPLLGSLPGL+ N +RMHDWIA NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLR-GPRVWPLLGSLPGLIENCDRMHDWIADNLRACGGTYQT 66 >emb|CAN80156.1| hypothetical protein VITISV_023926 [Vitis vinifera] Length = 547 Score = 83.2 bits (204), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SLR GPRVWPLLGSLPGL+ N+ERMH+WIA NL+A GGTYQT Sbjct: 6 YLLWFTFISRSLR-GPRVWPLLGSLPGLIENSERMHEWIAENLRACGGTYQT 56 >ref|XP_019190414.1| PREDICTED: cytochrome P450 86A8-like [Ipomoea nil] Length = 550 Score = 83.2 bits (204), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 158 YLFWFYNLLPSLRRGPRVWPLLGSLPGLVHNAERMHDWIASNLQAAGGTYQT 3 YL WF + SL+ GPRVWPLLGSLPGL+ NAERMH+WIA NL+A GGTYQT Sbjct: 16 YLLWFTFISRSLK-GPRVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQT 66