BLASTX nr result
ID: Ophiopogon22_contig00039094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039094 (573 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM46711.1| hypothetical protein ABT39_MTgene1391 (mitochondr... 58 3e-07 >gb|KUM46711.1| hypothetical protein ABT39_MTgene1391 (mitochondrion) [Picea glauca] Length = 142 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/60 (45%), Positives = 43/60 (71%) Frame = -1 Query: 294 KVWKGRLKDFFEEERLLADRRLQGVGLNREMQRLQWKNFFLEIKVRGLRRALSDRFPRGG 115 KVW+ RLK + EER + DR LQ + +++++Q+L WK FF E++ +G +RA+S+R R G Sbjct: 83 KVWEERLKGWEAEERQVKDRALQSLLIHKDIQKLGWKTFFSEMRRQGPKRAISERKNRRG 142