BLASTX nr result
ID: Ophiopogon22_contig00039014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00039014 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271693.1| pentatricopeptide repeat-containing protein ... 94 2e-19 gb|ONK62907.1| uncharacterized protein A4U43_C07F9360 [Asparagus... 94 2e-19 ref|XP_020580728.1| pentatricopeptide repeat-containing protein ... 63 1e-08 ref|XP_020688556.1| pentatricopeptide repeat-containing protein ... 60 1e-07 ref|XP_010942480.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 >ref|XP_020271693.1| pentatricopeptide repeat-containing protein At2g30780, partial [Asparagus officinalis] Length = 462 Score = 94.0 bits (232), Expect = 2e-19 Identities = 53/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%) Frame = +3 Query: 84 NHLNDYICLLAEKP-SVISDDDLYGNVVRVSSITEIELAVEDMESVTGVLEERSVVDLLR 260 + + D I LL EKP S+ISD DL RVSSI + L +ED+E V GVL+ RSVVDLLR Sbjct: 3 DRIRDRIHLLTEKPTSLISDGDLDDIKARVSSIADEILTLEDVERVAGVLDARSVVDLLR 62 Query: 261 RSPNGFAFVELLSRLKEKPHFTYEIYS 341 RSPNG A VELLSRLK KPHF E+++ Sbjct: 63 RSPNGSASVELLSRLKAKPHFALEVFN 89 >gb|ONK62907.1| uncharacterized protein A4U43_C07F9360 [Asparagus officinalis] Length = 497 Score = 94.0 bits (232), Expect = 2e-19 Identities = 53/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%) Frame = +3 Query: 84 NHLNDYICLLAEKP-SVISDDDLYGNVVRVSSITEIELAVEDMESVTGVLEERSVVDLLR 260 + + D I LL EKP S+ISD DL RVSSI + L +ED+E V GVL+ RSVVDLLR Sbjct: 38 DRIRDRIHLLTEKPTSLISDGDLDDIKARVSSIADEILTLEDVERVAGVLDARSVVDLLR 97 Query: 261 RSPNGFAFVELLSRLKEKPHFTYEIYS 341 RSPNG A VELLSRLK KPHF E+++ Sbjct: 98 RSPNGSASVELLSRLKAKPHFALEVFN 124 >ref|XP_020580728.1| pentatricopeptide repeat-containing protein At2g30780 [Phalaenopsis equestris] Length = 522 Score = 63.2 bits (152), Expect = 1e-08 Identities = 40/101 (39%), Positives = 54/101 (53%), Gaps = 10/101 (9%) Frame = +3 Query: 66 CSCGRTNHLNDYICLLAEKP-SVISDDDLYGNVVRVSSITEIELAV---------EDMES 215 CS L + I LL EKP SV D D+ +VSS+ + LA +D+ Sbjct: 49 CSSDDITDLRERILLLTEKPTSVTQDGDVDDIRSQVSSLADELLAAGHLANLEDDDDLTD 108 Query: 216 VTGVLEERSVVDLLRRSPNGFAFVELLSRLKEKPHFTYEIY 338 + L+ RS V LLR SP+G AFVELLSRLK +P +++ Sbjct: 109 LAAFLDSRSAVSLLRHSPSGLAFVELLSRLKTRPRLAVQVF 149 >ref|XP_020688556.1| pentatricopeptide repeat-containing protein At2g30780 [Dendrobium catenatum] ref|XP_020688557.1| pentatricopeptide repeat-containing protein At2g30780 [Dendrobium catenatum] ref|XP_020688558.1| pentatricopeptide repeat-containing protein At2g30780 [Dendrobium catenatum] ref|XP_020688559.1| pentatricopeptide repeat-containing protein At2g30780 [Dendrobium catenatum] ref|XP_020688560.1| pentatricopeptide repeat-containing protein At2g30780 [Dendrobium catenatum] gb|PKU85808.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 524 Score = 60.5 bits (145), Expect = 1e-07 Identities = 36/93 (38%), Positives = 53/93 (56%), Gaps = 10/93 (10%) Frame = +3 Query: 90 LNDYICLLAEKPSVISDDDLYGNV-VRVSSITEIELAV---------EDMESVTGVLEER 239 L + I LL EKPS+I D + +VSS+ + LA+ +D+ + L+ R Sbjct: 59 LRERILLLTEKPSIIRQDGEVDAIRSQVSSLADELLAMGHLANLADDDDLTDLAAFLDSR 118 Query: 240 SVVDLLRRSPNGFAFVELLSRLKEKPHFTYEIY 338 S V LLRRSP+G AFVELL RL+ +P +++ Sbjct: 119 STVSLLRRSPSGLAFVELLFRLRSRPRLAVQVF 151 >ref|XP_010942480.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Elaeis guineensis] Length = 515 Score = 59.3 bits (142), Expect = 3e-07 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = +3 Query: 90 LNDYICLLAEKPSVISDDDLYGNV-VRVSSITEIELAVEDMESVTGVLEERSVVDLLRRS 266 L D + LL EK S I D + VS++ + L V D + + GVL+ S L RRS Sbjct: 60 LRDGVLLLTEKTSSIHTDGEREKLRATVSALADELLTVPDHQEIAGVLDSCSADALFRRS 119 Query: 267 PNGFAFVELLSRLKEKPHFTYEIYS 341 PNGFA +ELLS LK +P E+++ Sbjct: 120 PNGFASIELLSHLKSRPLLALEVFN 144