BLASTX nr result
ID: Ophiopogon22_contig00038753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00038753 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266915.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 71 1e-11 ref|XP_010924115.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-09 gb|PIA29307.1| hypothetical protein AQUCO_06100077v1, partial [A... 60 1e-07 ref|XP_008365381.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_011084656.1| pentatricopeptide repeat-containing protein ... 59 2e-07 emb|CBI15512.3| unnamed protein product, partial [Vitis vinifera] 59 3e-07 ref|XP_010663648.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_016695188.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_012489526.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_016695187.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_012489525.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 emb|CAN65388.1| hypothetical protein VITISV_038361 [Vitis vinifera] 58 4e-07 ref|XP_009334116.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-07 ref|XP_017975165.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_021299371.1| pentatricopeptide repeat-containing protein ... 57 1e-06 ref|XP_021299369.1| pentatricopeptide repeat-containing protein ... 57 1e-06 ref|XP_022740098.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 57 1e-06 ref|XP_010108815.2| pentatricopeptide repeat-containing protein ... 57 1e-06 gb|EXC20330.1| hypothetical protein L484_020550 [Morus notabilis] 57 1e-06 ref|XP_017698876.1| PREDICTED: pentatricopeptide repeat-containi... 56 2e-06 >ref|XP_020266915.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g40400 [Asparagus officinalis] Length = 585 Score = 70.9 bits (172), Expect = 1e-11 Identities = 35/67 (52%), Positives = 47/67 (70%) Frame = -3 Query: 314 YPNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFN 135 +P+ DP+SSLL SS+ + SP+VF LL+ A LRL Q+ AV TLRRL +G P+ H+FN Sbjct: 120 HPHIDPLSSLLSSSQLSCSSPSVFGLLVNAQLRLGQLSAAVETLRRLTRLGLPPNSHTFN 179 Query: 134 CVLNSLL 114 VL L+ Sbjct: 180 SVLRGLV 186 >ref|XP_010924115.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Elaeis guineensis] ref|XP_010924116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Elaeis guineensis] ref|XP_019706957.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Elaeis guineensis] Length = 632 Score = 63.2 bits (152), Expect = 7e-09 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = -3 Query: 314 YPNHDPISSLLESSRAA-NPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSF 138 +P+ D +L+ SS A N PAVF +L+K ++L +I A+ T RR IH+GF P ++F Sbjct: 173 HPHLDAFQALVASSAAGCNWDPAVFGMLVKVQVKLGRIADALDTCRRAIHLGFAPDANAF 232 Query: 137 NCVLNSLL 114 NC+LNSL+ Sbjct: 233 NCLLNSLV 240 >gb|PIA29307.1| hypothetical protein AQUCO_06100077v1, partial [Aquilegia coerulea] Length = 618 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/67 (38%), Positives = 43/67 (64%) Frame = -3 Query: 314 YPNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFN 135 YP D +L+ + N SP VFD+LIKA++++ +I ++ +++I IGF+P + N Sbjct: 153 YPREDIFRNLVLCTEGCNWSPIVFDMLIKAYVKMGKIEEGLKAFKKMIKIGFVPDVSACN 212 Query: 134 CVLNSLL 114 C+LN LL Sbjct: 213 CLLNGLL 219 >ref|XP_008365381.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Malus domestica] Length = 639 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P D SL+ + N P VFD+LIKA+++ IR + T R+++ +GF+PS S NC Sbjct: 176 PKDDIFRSLVSCTEDCNWDPVVFDMLIKAYVKAGMIRDGLSTFRKIVEVGFVPSVVSCNC 235 Query: 131 VLNSLL 114 +LN L+ Sbjct: 236 LLNGLV 241 >ref|XP_011084656.1| pentatricopeptide repeat-containing protein At5g40400 [Sesamum indicum] Length = 626 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = -3 Query: 290 SLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLNSL 117 SL+ S+ N PAVFD+LIKA+LR ++ + RT R++I GF+PS + NC+LN L Sbjct: 169 SLILSTNDCNWDPAVFDMLIKAYLRKGMVKESFRTFRKIIRAGFVPSIVTINCLLNGL 226 >emb|CBI15512.3| unnamed protein product, partial [Vitis vinifera] Length = 660 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/66 (37%), Positives = 44/66 (66%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P+ D +L+ + N P VFD+L+KA+LR+ ++R +R+ RR++ +GF+P+ + N Sbjct: 169 PSEDVFKNLILCTEDCNWDPVVFDMLVKAYLRMGRVREGLRSFRRMLRVGFVPTVITSNY 228 Query: 131 VLNSLL 114 +LN LL Sbjct: 229 LLNGLL 234 >ref|XP_010663648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] ref|XP_010663649.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] ref|XP_019082060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] ref|XP_019082061.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] ref|XP_019082062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] ref|XP_019082063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vitis vinifera] Length = 677 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/66 (37%), Positives = 44/66 (66%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P+ D +L+ + N P VFD+L+KA+LR+ ++R +R+ RR++ +GF+P+ + N Sbjct: 215 PSEDVFKNLILCTEDCNWDPVVFDMLVKAYLRMGRVREGLRSFRRMLRVGFVPTVITSNY 274 Query: 131 VLNSLL 114 +LN LL Sbjct: 275 LLNGLL 280 >ref|XP_016695188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X2 [Gossypium hirsutum] Length = 529 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = -3 Query: 302 DPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLN 123 D SL+ S+ N P VFD+LIK ++R ++ A+RT ++ +G+LPS + NC+LN Sbjct: 168 DLFESLVSCSKDCNFDPVVFDMLIKGYVRKGMVKEAIRTFTNVLEVGYLPSVITCNCLLN 227 Query: 122 SLL 114 LL Sbjct: 228 GLL 230 >ref|XP_012489526.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 isoform X2 [Gossypium raimondii] gb|KJB40745.1| hypothetical protein B456_007G075800 [Gossypium raimondii] Length = 531 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = -3 Query: 302 DPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLN 123 D SL+ S+ N P VFD+LIK ++R ++ A+RT ++ +G+LPS + NC+LN Sbjct: 168 DLFESLVSCSKDCNFDPVVFDMLIKGYVRKGMVKEAIRTFTNVLEVGYLPSVITCNCLLN 227 Query: 122 SLL 114 LL Sbjct: 228 GLL 230 >ref|XP_016695187.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X1 [Gossypium hirsutum] Length = 628 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = -3 Query: 302 DPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLN 123 D SL+ S+ N P VFD+LIK ++R ++ A+RT ++ +G+LPS + NC+LN Sbjct: 168 DLFESLVSCSKDCNFDPVVFDMLIKGYVRKGMVKEAIRTFTNVLEVGYLPSVITCNCLLN 227 Query: 122 SLL 114 LL Sbjct: 228 GLL 230 >ref|XP_012489525.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 isoform X1 [Gossypium raimondii] Length = 628 Score = 58.2 bits (139), Expect = 4e-07 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = -3 Query: 302 DPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLN 123 D SL+ S+ N P VFD+LIK ++R ++ A+RT ++ +G+LPS + NC+LN Sbjct: 168 DLFESLVSCSKDCNFDPVVFDMLIKGYVRKGMVKEAIRTFTNVLEVGYLPSVITCNCLLN 227 Query: 122 SLL 114 LL Sbjct: 228 GLL 230 >emb|CAN65388.1| hypothetical protein VITISV_038361 [Vitis vinifera] Length = 676 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/66 (37%), Positives = 43/66 (65%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P D +L+ + N P VFD+L+KA+LR+ ++R +R+ RR++ +GF+P+ + N Sbjct: 214 PGEDVFKNLILCTEDCNWDPVVFDMLVKAYLRMGRVREGLRSFRRMLRVGFVPTVITSNY 273 Query: 131 VLNSLL 114 +LN LL Sbjct: 274 LLNGLL 279 >ref|XP_009334116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Pyrus x bretschneideri] Length = 638 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P D SL+ + N P VFD+LIKA+++ IR + T R++++ GF+PS S NC Sbjct: 175 PKDDIFQSLVSCTEDCNWDPVVFDMLIKAYVKAGMIRGGLSTFRKIVNDGFVPSVVSCNC 234 Query: 131 VLNSLL 114 +LN L+ Sbjct: 235 LLNGLV 240 >ref|XP_017975165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Theobroma cacao] Length = 668 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = -3 Query: 290 SLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLNSLL 114 SL+ S+ N P VFD+LIK ++R ++R T R ++ +GFLPS S NC+LN LL Sbjct: 174 SLVFCSKDCNFDPVVFDMLIKGYVRKGRVREGFMTFRNILEVGFLPSVISCNCLLNGLL 232 >ref|XP_021299371.1| pentatricopeptide repeat-containing protein At5g40400 isoform X2 [Herrania umbratica] Length = 511 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = -3 Query: 290 SLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLNSLL 114 SL+ S+ N P VFD+LIK ++R +R T R ++ +GFLPS S NC+LN LL Sbjct: 169 SLVFCSKDCNFDPVVFDMLIKGYVRKGMVREGFMTFRNILEVGFLPSVISCNCLLNGLL 227 >ref|XP_021299369.1| pentatricopeptide repeat-containing protein At5g40400 isoform X1 [Herrania umbratica] Length = 625 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = -3 Query: 290 SLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCVLNSLL 114 SL+ S+ N P VFD+LIK ++R +R T R ++ +GFLPS S NC+LN LL Sbjct: 169 SLVFCSKDCNFDPVVFDMLIKGYVRKGMVREGFMTFRNILEVGFLPSVISCNCLLNGLL 227 >ref|XP_022740098.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g40400 [Durio zibethinus] Length = 636 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = -3 Query: 308 NHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNCV 129 + D SL+ ++ N PAVFD+L+K ++R +R V+T R ++ +GFLPS S N + Sbjct: 162 SEDVFESLVFCTKDCNFDPAVFDMLVKGYVRKGMVREGVKTFRNILGVGFLPSVISCNFL 221 Query: 128 LNSLL 114 LN LL Sbjct: 222 LNGLL 226 >ref|XP_010108815.2| pentatricopeptide repeat-containing protein At5g40400 [Morus notabilis] Length = 644 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P D L+ S+ N P VFD+LIKA+++ IR T R++I +GF PS S NC Sbjct: 179 PKDDIFQILISSAEDCNWDPVVFDMLIKAYVKSGMIREGFSTFRKIIEVGFFPSVISCNC 238 Query: 131 VLNSL 117 +L+ L Sbjct: 239 LLHGL 243 >gb|EXC20330.1| hypothetical protein L484_020550 [Morus notabilis] Length = 666 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = -3 Query: 311 PNHDPISSLLESSRAANPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSFNC 132 P D L+ S+ N P VFD+LIKA+++ IR T R++I +GF PS S NC Sbjct: 201 PKDDIFQILISSAEDCNWDPVVFDMLIKAYVKSGMIREGFSTFRKIIEVGFFPSVISCNC 260 Query: 131 VLNSL 117 +L+ L Sbjct: 261 LLHGL 265 >ref|XP_017698876.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Phoenix dactylifera] Length = 632 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/68 (39%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -3 Query: 314 YPNHDPISSLLESSRAA-NPSPAVFDLLIKAHLRLAQIRPAVRTLRRLIHIGFLPSPHSF 138 +P+ D +++ +S A N PAVF +L+K ++L +I A+ T RR + +GF P ++F Sbjct: 173 HPHLDAFQAVVAASAAGCNWDPAVFGMLVKVQVKLGRIVDALDTCRRAVDLGFAPDANAF 232 Query: 137 NCVLNSLL 114 NC+LNSL+ Sbjct: 233 NCLLNSLV 240