BLASTX nr result
ID: Ophiopogon22_contig00038711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00038711 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010910270.1| PREDICTED: plant UBX domain-containing prote... 55 8e-10 ref|XP_020251212.1| plant UBX domain-containing protein 2-like, ... 52 1e-09 ref|XP_008803480.1| PREDICTED: plant UBX domain-containing prote... 52 2e-08 ref|XP_008803481.1| PREDICTED: plant UBX domain-containing prote... 52 2e-08 ref|XP_020680558.1| plant UBX domain-containing protein 2 [Dendr... 45 8e-07 >ref|XP_010910270.1| PREDICTED: plant UBX domain-containing protein 2-like [Elaeis guineensis] Length = 291 Score = 55.1 bits (131), Expect(2) = 8e-10 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 478 VVKEPGNEKFRRIRMGNPKIKEAVGE 401 VV+EPGNEKFRRIRMGNPKIKEAVGE Sbjct: 188 VVREPGNEKFRRIRMGNPKIKEAVGE 213 Score = 35.8 bits (81), Expect(2) = 8e-10 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = -2 Query: 326 KLLECMXXXXXXXXXXGAWVTMEVIAEDRTWVIREAVALLERWK 195 +LLEC+ W TM AE++ V+R+AV+ LERWK Sbjct: 219 ELLECLGFELGEEGGE-VWATMPAPAEEQLAVVRQAVSFLERWK 261 >ref|XP_020251212.1| plant UBX domain-containing protein 2-like, partial [Asparagus officinalis] Length = 299 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 478 VVKEPGNEKFRRIRMGNPKIKEAVGE 401 V KEPGNEKFRRIRMGNPKIKEAV E Sbjct: 163 VAKEPGNEKFRRIRMGNPKIKEAVSE 188 Score = 38.1 bits (87), Expect(2) = 1e-09 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = -2 Query: 326 KLLECMXXXXXXXXXXGAWVTMEVIAEDRTWVIREAVALLERWKVGVAK 180 +LLE + W ME ED VI+EAV+LLERWK G K Sbjct: 194 ELLEILGFRIGEEEGGEVWGMMEAPTEDGVRVIKEAVSLLERWKEGGLK 242 >ref|XP_008803480.1| PREDICTED: plant UBX domain-containing protein 2 isoform X1 [Phoenix dactylifera] Length = 458 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 478 VVKEPGNEKFRRIRMGNPKIKEAVGE 401 VV+EP NEKFRRIRMGNPKIKEAVGE Sbjct: 181 VVREPENEKFRRIRMGNPKIKEAVGE 206 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -2 Query: 326 KLLECMXXXXXXXXXXGAWVTMEVIAEDRTWVIREAVALLERWK 195 +LLEC+ W TM V +E++ V+R+AV+ LE WK Sbjct: 212 ELLECLGFELGEEGGE-VWATMHVPSEEQLAVVRDAVSFLESWK 254 >ref|XP_008803481.1| PREDICTED: plant UBX domain-containing protein 2 isoform X2 [Phoenix dactylifera] Length = 397 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 478 VVKEPGNEKFRRIRMGNPKIKEAVGE 401 VV+EP NEKFRRIRMGNPKIKEAVGE Sbjct: 181 VVREPENEKFRRIRMGNPKIKEAVGE 206 Score = 34.3 bits (77), Expect(2) = 2e-08 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -2 Query: 326 KLLECMXXXXXXXXXXGAWVTMEVIAEDRTWVIREAVALLERWK 195 +LLEC+ W TM V +E++ V+R+AV+ LE WK Sbjct: 212 ELLECLGFELGEEGGE-VWATMHVPSEEQLAVVRDAVSFLESWK 254 >ref|XP_020680558.1| plant UBX domain-containing protein 2 [Dendrobium catenatum] gb|PKU68668.1| hypothetical protein MA16_Dca024962 [Dendrobium catenatum] Length = 426 Score = 45.4 bits (106), Expect(2) = 8e-07 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -3 Query: 478 VVKEPGNEKFRRIRMGNPKIKEAVGE 401 + +EP NEKFR+IRMGNP+IKEA+G+ Sbjct: 148 LTREPRNEKFRKIRMGNPRIKEAIGD 173 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = -2 Query: 326 KLLECMXXXXXXXXXXGAWVTMEVIAEDRTWVIREAVALLERWKV 192 +LLEC+ W TM +R VI+EAV+LLERWKV Sbjct: 179 ELLECVGFRIQEEDGEK-WATMGEPTRERIAVIQEAVSLLERWKV 222