BLASTX nr result
ID: Ophiopogon22_contig00038327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00038327 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245105.1| uncharacterized protein LOC109823228 [Aspara... 64 3e-10 gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagu... 59 6e-08 >ref|XP_020245105.1| uncharacterized protein LOC109823228 [Asparagus officinalis] Length = 158 Score = 64.3 bits (155), Expect = 3e-10 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = -1 Query: 155 MPSKYDDMIVAYALSVESIEDSVPTTFREAEISSESDLWREAICKEMHSLH 3 +P+ Y +++V YAL VESI++ VPTT+REAE SE+DLW++A+ +EM SLH Sbjct: 90 LPAMYMNIVVVYALPVESIDEMVPTTYREAEQISETDLWQKAMQEEMKSLH 140 >gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagus officinalis] Length = 162 Score = 58.5 bits (140), Expect = 6e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -1 Query: 143 YDDMIVAYALSVESIEDSVPTTFREAEISSESDLWREAICKEMHSL 6 Y+D+IVAYALS+E ++D VP+TFREAE SS S W EA+ +E+ SL Sbjct: 39 YNDVIVAYALSIEVVDDMVPSTFREAESSSNSIRWMEAMEEEIRSL 84