BLASTX nr result
ID: Ophiopogon22_contig00038037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00038037 (581 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkho... 201 4e-62 dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE6... 201 4e-62 dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE6... 201 4e-62 dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia mul... 201 4e-62 emb|CNT62590.1| Cell wall-associated hydrolase [Neisseria gonorr... 195 2e-60 gb|ACS96861.1| cell wall-associated hydrolase [Aggregatibacter a... 194 2e-60 emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria mening... 195 6e-60 emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria mening... 195 6e-60 emb|CWP48701.1| Cell wall-associated hydrolase [Neisseria mening... 195 6e-60 emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria mening... 195 6e-60 emb|CNS09044.1| Cell wall-associated hydrolase [Neisseria gonorr... 195 6e-60 gb|EEW06587.1| conserved hypothetical protein [Vibrio mimicus VM... 192 1e-59 gb|KNH50143.1| cell wall-associated hydrolase, partial [Vibrio c... 191 1e-59 gb|EGR05231.1| cell wall-associated hydrolase, partial [Vibrio c... 191 3e-59 gb|KTD43806.1| Cell wall-associated hydrolase [Legionella oakrid... 190 3e-59 gb|KTD17649.1| Cell wall-associated hydrolase [Legionella jordanis] 190 3e-59 gb|KNH56572.1| cell wall-associated hydrolase, partial [Vibrio c... 191 3e-59 gb|ELT25191.1| cell wall-associated hydrolase [Vibrio cholerae H... 191 3e-59 gb|EGR07003.1| cell wall-associated hydrolase [Vibrio cholerae H... 191 3e-59 emb|CBY81656.1| Cell wall-associated hydrolase [Haemophilus infl... 191 3e-59 >gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 201 bits (512), Expect = 4e-62 Identities = 100/123 (81%), Positives = 102/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVISS SY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87487.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87598.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 201 bits (512), Expect = 4e-62 Identities = 100/123 (81%), Positives = 102/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVISS SY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO88159.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO90886.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 201 bits (512), Expect = 4e-62 Identities = 100/123 (81%), Positives = 102/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVISS SY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 201 bits (512), Expect = 4e-62 Identities = 100/123 (81%), Positives = 102/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVISS SY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CNT62590.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 177 Score = 195 bits (496), Expect = 2e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|ACS96861.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] gb|ACS96997.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] gb|ACS97765.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] gb|ACS98076.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] gb|ACS98254.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] gb|ACS98444.1| cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] Length = 144 Score = 194 bits (492), Expect = 2e-60 Identities = 96/123 (78%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISSALSY AM LA QP HQRCV TPTADRD+TVSRR KPSS Sbjct: 1 MLSALISSALSYPAMRLATQPEHQRCVHSGPLVLGAAPTNSPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFH EPP Sbjct: 61 RTTLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHAEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS73015.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48004.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53749.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP56073.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45211.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP40556.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34214.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 6e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59615.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS18382.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45378.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ16501.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN87478.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM92680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67326.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP45878.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP38468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ30366.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO45593.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45368.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35122.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ61517.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR11989.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT68492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP89907.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM28216.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ55809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM90768.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ97896.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS39350.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO06049.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN51672.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM72155.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO27120.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ78977.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62225.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS89623.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM32710.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 6e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CWP48701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR29009.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR82218.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR46809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS91548.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN30464.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN27922.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS66742.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR06838.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR48486.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR10327.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN24095.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO60614.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN25947.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS98001.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS59497.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN72848.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP39092.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ32365.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR13329.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR32013.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO60288.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO73300.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO97724.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM32626.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR46169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR60621.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS55187.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO74333.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS49369.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN33205.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT97847.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO92715.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT28786.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS90747.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM57104.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS63743.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO03883.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS61697.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO81400.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT19600.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS68250.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO24807.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT09763.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR74708.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP19917.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP84832.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03601.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS70498.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN63518.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36222.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR66421.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO88263.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO98192.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS47444.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT98357.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS64753.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS46428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS76708.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO66988.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM84030.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR78250.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34318.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT95575.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM57972.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ57771.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ39864.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO66358.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM94174.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP76809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO82057.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO41141.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43448.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR92606.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO68101.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03041.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR09158.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ50251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR40772.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO02003.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN69442.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM99199.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97164.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO86758.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS41307.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT95437.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM63050.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP38428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM29569.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR37263.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR81410.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT48259.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM97468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN50119.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM76951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN34996.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65665.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP39424.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ41661.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92488.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ79228.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM13605.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT09979.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT10765.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN20861.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT20193.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP85087.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ46953.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO47217.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR53907.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN72701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT19570.1| Cell wall-associated hydrolase [Neisseria meningitidis] gb|ANW90621.1| hypothetical protein DE8555_0048 [Neisseria meningitidis] gb|ANW92138.1| hypothetical protein DE8555_1596 [Neisseria meningitidis] gb|ANW92423.1| hypothetical protein DE8555_1889 [Neisseria meningitidis] gb|ANW92538.1| hypothetical protein DE8555_2009 [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 6e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43812.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS31701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93279.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT88142.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP62169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO09337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97823.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 195 bits (496), Expect = 6e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CNS09044.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN05702.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN12195.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN08284.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN16001.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM98005.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN00296.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN07672.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM92021.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBM98469.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN02983.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN10314.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] emb|SBN06757.1| Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 216 Score = 195 bits (496), Expect = 6e-60 Identities = 97/123 (78%), Positives = 101/123 (82%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISS LSY AM LA QP+HQR V TPTADRDQTVSRRFKPSS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAK RRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|EEW06587.1| conserved hypothetical protein [Vibrio mimicus VM603] Length = 144 Score = 192 bits (487), Expect = 1e-59 Identities = 96/123 (78%), Positives = 99/123 (80%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVI S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|KNH50143.1| cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 124 Score = 191 bits (485), Expect = 1e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+I+S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|EGR05231.1| cell wall-associated hydrolase, partial [Vibrio cholerae HCUF01] Length = 142 Score = 191 bits (485), Expect = 3e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+I+S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|KTD43806.1| Cell wall-associated hydrolase [Legionella oakridgensis] Length = 122 Score = 190 bits (483), Expect = 3e-59 Identities = 95/122 (77%), Positives = 98/122 (80%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVI S LSY AM LA QP+HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSAVIPSKLSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DH 539 DH Sbjct: 121 DH 122 >gb|KTD17649.1| Cell wall-associated hydrolase [Legionella jordanis] Length = 122 Score = 190 bits (483), Expect = 3e-59 Identities = 95/122 (77%), Positives = 98/122 (80%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSAVI S LSY AM LA QP+HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSAVIPSELSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DH 539 DH Sbjct: 121 DH 122 >gb|KNH56572.1| cell wall-associated hydrolase, partial [Vibrio cholerae 1587] Length = 144 Score = 191 bits (485), Expect = 3e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+I+S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|ELT25191.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] Length = 144 Score = 191 bits (485), Expect = 3e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+I+S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSALINSELSYRAMRLAAQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >gb|EGR07003.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] Length = 144 Score = 191 bits (485), Expect = 3e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+I+S LSY AM LA QP HQR V TPTADRD+TVSRR KPSS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAHFNLPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWDRLQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP Sbjct: 61 RTTLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123 >emb|CBY81656.1| Cell wall-associated hydrolase [Haemophilus influenzae F3031] gb|EGT73921.1| cell wall-associated hydrolase [Haemophilus haemolyticus M19501] gb|EGT73925.1| cell wall-associated hydrolase [Haemophilus haemolyticus M21127] gb|EGT77125.1| cell wall-associated hydrolase [Haemophilus haemolyticus M19501] gb|EGT78193.1| cell wall-associated hydrolase [Haemophilus haemolyticus M21621] gb|EGT78466.1| cell wall-associated hydrolase [Haemophilus haemolyticus M21639] gb|AGV11013.1| cell wall-associated hydrolase [Haemophilus influenzae KR494] gb|AGV11070.1| ell wall-associated hydrolase [Haemophilus influenzae KR494] gb|AGV12209.1| cell wall-associated hydrolase [Haemophilus influenzae KR494] gb|AGV12380.1| cell wall-associated hydrolase [Haemophilus influenzae KR494] gb|AGV12403.1| cell wall-associated hydrolase [Haemophilus influenzae KR494] gb|AGV12445.1| cell wall-associated hydrolase [Haemophilus influenzae KR494] emb|CWX68947.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX30570.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX41588.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX24397.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX41200.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWW54560.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX88584.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX45135.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX24953.1| cell wall-associated hydrolase [Haemophilus influenzae] emb|CWX64479.1| cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI22084.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI25584.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI35932.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI39614.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI40595.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI42813.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI43628.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI54446.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI58061.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI61718.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI64961.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI68763.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI72092.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI72857.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI76418.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI77778.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI82631.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI88184.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRI89676.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ11001.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ15444.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ23099.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ32028.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ46556.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ47747.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ54974.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ58253.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ63613.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ64148.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ65647.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ67021.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ69327.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ70397.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ70811.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ75015.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ77863.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ77961.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ80492.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ80631.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ83374.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ90540.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ95870.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ96413.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRJ98723.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK03773.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK09313.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK12881.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK15367.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK17066.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK34340.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK40816.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK43121.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK44043.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK47539.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK49621.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK51304.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK53429.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK57231.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK61356.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK61357.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK76551.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK79719.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK80403.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK81433.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK93663.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRK97468.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL00706.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL03572.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL14686.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL23890.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL35899.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL45583.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL51521.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL62307.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL66849.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL70542.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL84169.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRL88205.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM06906.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM15807.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM17259.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM19428.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM24111.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM26098.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM29759.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM35444.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM36045.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM39965.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM47768.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM48051.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM52031.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM61087.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM68318.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM69277.1| Cell wall-associated hydrolase [Haemophilus influenzae] gb|PRM84790.1| Cell wall-associated hydrolase [Haemophilus influenzae] Length = 144 Score = 191 bits (485), Expect = 3e-59 Identities = 95/123 (77%), Positives = 100/123 (81%) Frame = +3 Query: 174 MLSAVISSALSYSAMPLA*QPIHQRCVXXXXXXXXXXXXXXXTPTADRDQTVSRRFKPSS 353 MLSA+ISSALSY AM LA QP HQ CV TPTADRD+TVSRR KPSS Sbjct: 1 MLSALISSALSYPAMRLATQPEHQWCVHSGPLVLGAAPTNSPTPTADRDRTVSRRSKPSS 60 Query: 354 RTSLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPP 533 RT+LNGEQPYPWD LQPQD MSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFH+EPP Sbjct: 61 RTTLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHSEPP 120 Query: 534 DHF 542 DH+ Sbjct: 121 DHY 123