BLASTX nr result
ID: Ophiopogon22_contig00037883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00037883 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269943.1| probable histidine kinase 2 [Asparagus offic... 58 2e-06 >ref|XP_020269943.1| probable histidine kinase 2 [Asparagus officinalis] gb|ONK65892.1| uncharacterized protein A4U43_C06F2050 [Asparagus officinalis] Length = 1064 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 4 LSAHATLEDEKKAILAGMDLYLMKPISGERIIEAVRRFHPN 126 L+AHAT E+EKKAIL+GMD YL KPI+ ER+IEA+R N Sbjct: 1024 LTAHATSEEEKKAILSGMDSYLTKPINAERVIEAIRLIRQN 1064