BLASTX nr result
ID: Ophiopogon22_contig00037247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00037247 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP13262.1| hypothetical protein COLO4_01988 [Corchorus olito... 68 2e-20 gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] 83 4e-17 ref|XP_013468915.1| hypothetical protein MTR_1g078350 [Medicago ... 70 4e-11 gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus cl... 67 4e-11 ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabac... 62 3e-09 dbj|GAU48488.1| hypothetical protein TSUD_291730 [Trifolium subt... 48 2e-08 gb|PHU10897.1| hypothetical protein BC332_17827 [Capsicum chinense] 62 6e-08 gb|PNY15720.1| hypothetical protein L195_g012422 [Trifolium prat... 48 3e-07 >gb|OMP13262.1| hypothetical protein COLO4_01988 [Corchorus olitorius] Length = 82 Score = 67.8 bits (164), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +3 Query: 108 TGNGLPTPNGQSEPFNSILHSLMKLRINQISPSRIRTYDQSVNSRPLY 251 TGNGLP NGQSEPF+S +++ +NQIS SRIRTYDQSVNSRPLY Sbjct: 37 TGNGLPALNGQSEPFHS---DILEYGMNQISSSRIRTYDQSVNSRPLY 81 Score = 59.3 bits (142), Expect(2) = 2e-20 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +2 Query: 14 ITPDLRRGIDGDSQIS*NRM*YDEIECNRNKD 109 I PDL RGIDGDSQIS NRM YDEIECNRNKD Sbjct: 5 IIPDLHRGIDGDSQISQNRMGYDEIECNRNKD 36 >gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] Length = 112 Score = 83.2 bits (204), Expect = 4e-17 Identities = 56/100 (56%), Positives = 62/100 (62%), Gaps = 2/100 (2%) Frame = +1 Query: 202 QVGFEPTTNQLTADRSTTELLRKNSLKEADSRSLDQPTYDRKEKKFRNFLFFTYTGRKGD 381 +VG T N ADRSTTELLR N LKEADSRSLDQP E+K+ F G K Sbjct: 25 KVGCGYTAN---ADRSTTELLRNNRLKEADSRSLDQP---MTEQKWVRHSFSHTPGEKVT 78 Query: 382 --DSNPLCLPGRRASRTGQGGGGQPSTLDMHIDQSISASC 495 S+P P GQGGGGQPSTL++HIDQSISASC Sbjct: 79 IASSSPAGEP------PGQGGGGQPSTLEIHIDQSISASC 112 >ref|XP_013468915.1| hypothetical protein MTR_1g078350 [Medicago truncatula] gb|KEH42952.1| hypothetical protein MTR_1g078350 [Medicago truncatula] Length = 195 Score = 69.7 bits (169), Expect = 4e-11 Identities = 42/68 (61%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +1 Query: 196 SPQVGFEPTTNQLTADRSTTELLRKNSLK-EADSRSLDQPTYDRKEKKFRNFLFFTYTGR 372 SPQVGFE TTN+LTADRSTTELL N LK + L PTY R +K LF TYT R Sbjct: 104 SPQVGFESTTNRLTADRSTTELLSNNGLKLRKPTLVLWTPTYGRAKKGLS--LFSTYTRR 161 Query: 373 KGDDSNPL 396 KG DS PL Sbjct: 162 KGYDSKPL 169 >gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 67.4 bits (163), Expect = 4e-11 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = +2 Query: 14 ITPDLRRGIDGDSQIS*NRM*YDEIECNRNKDRERVTYP*RSKRAL*FNSSFFNE-IKNQ 190 I PDL RGIDGDSQIS NRM YDEIECNRNKD P + ++ F+S N I+N+ Sbjct: 45 IIPDLHRGIDGDSQISQNRMGYDEIECNRNKDTGN-GLPTFNGQSEPFHSDILNSLIRNE 103 Query: 191 SNLPK 205 SNLPK Sbjct: 104 SNLPK 108 >ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabacum] ref|NP_054565.1| hypothetical protein NitaCp091 [Nicotiana tabacum] ref|YP_358732.1| hypothetical protein NisyCp089 [Nicotiana sylvestris] ref|YP_358746.1| hypothetical protein NisyCp103 [Nicotiana sylvestris] ref|YP_398918.1| hypothetical protein NitoCp088 [Nicotiana tomentosiformis] ref|YP_398932.1| hypothetical protein NitoCp102 [Nicotiana tomentosiformis] ref|YP_004891661.1| unnamed protein product (chloroplast) [Nicotiana undulata] ref|YP_004891675.1| unnamed protein product (chloroplast) [Nicotiana undulata] emb|CAA26288.1| hypothetical protein (chloroplast) [Nicotiana tabacum] emb|CAA77393.1| hypothetical protein (chloroplast) [Nicotiana tabacum] gb|AAA84690.1| unknown (chloroplast) [Nicotiana tabacum] emb|CAA77400.1| hypothetical protein (chloroplast) [Nicotiana tabacum] dbj|BAE46709.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE46723.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE48058.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] dbj|BAE48072.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] gb|AEO95619.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95646.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95728.1| hypothetical protein [synthetic construct] gb|AEO95754.1| hypothetical protein [synthetic construct] gb|AMM05595.1| hypothetical protein (plastid) [Nicotiana tabacum] prf||1211235CK ORF 75 Length = 75 Score = 61.6 bits (148), Expect = 3e-09 Identities = 35/47 (74%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = -1 Query: 314 VGWSKERESASLRE---FFLSSSVVERSAVN*LVVGSNPTWGDLIDS 183 +GW ERE S+R FLSSSVVERSAVN LVVGSNPTWGDLIDS Sbjct: 25 MGW--ERELNSMRSNLLLFLSSSVVERSAVNRLVVGSNPTWGDLIDS 69 >dbj|GAU48488.1| hypothetical protein TSUD_291730 [Trifolium subterraneum] Length = 67 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -3 Query: 495 AGRGDRLINMHIESGWLTAAPLS 427 AGRGDRLINM++ESGWLTAAPLS Sbjct: 26 AGRGDRLINMNLESGWLTAAPLS 48 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 427 LSWRLSGRGGKGDCYRHPFSRCM 359 LSWRLSGRGG CYR+ FSRCM Sbjct: 47 LSWRLSGRGGA--CYRNLFSRCM 67 >gb|PHU10897.1| hypothetical protein BC332_17827 [Capsicum chinense] Length = 324 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = +1 Query: 106 RQGTGYLPLTVKASPLIQFFIL**N*ESIKSPQVGFEPTTNQLTADRSTTELLRKN 273 + G G + ++ PL F N ESIKSPQVGFEPTTN+LTADRSTTELLR N Sbjct: 83 KTGNGLPTVNGQSEPLYSEFF---NSESIKSPQVGFEPTTNRLTADRSTTELLRNN 135 >gb|PNY15720.1| hypothetical protein L195_g012422 [Trifolium pratense] Length = 92 Score = 47.8 bits (112), Expect(2) = 3e-07 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -3 Query: 495 AGRGDRLINMHIESGWLTAAPLS 427 AGRGDRLINM++ESGWLTAAPLS Sbjct: 26 AGRGDRLINMNLESGWLTAAPLS 48 Score = 35.0 bits (79), Expect(2) = 3e-07 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 427 LSWRLSGRGGKGDCYRHPFSRCM*KRESYGTFF-LFGHRLVGPKNESR 287 LSWRLSGRGG CYR+ FSR E +G+F H L +R Sbjct: 47 LSWRLSGRGGA--CYRNLFSRF----EEHGSFIHSLAHELAASPEATR 88