BLASTX nr result
ID: Ophiopogon22_contig00037108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00037108 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas tit... 216 2e-69 dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE6... 201 3e-62 dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE6... 200 4e-62 dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia mul... 197 1e-60 gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkho... 195 4e-60 gb|ABM53543.1| conserved hypothetical protein [uncultured beta p... 168 6e-51 gb|ABJ03470.1| conserved hypothetical protein [Escherichia coli ... 141 6e-51 emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria mening... 166 5e-49 emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria mening... 166 7e-49 emb|CRY95131.1| hypothetical protein [uncultured prokaryote] 163 2e-48 emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria mening... 164 2e-48 emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria mening... 163 5e-48 emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria mening... 163 5e-48 emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria mening... 163 8e-48 gb|ELL01666.1| hypothetical protein NM4119_1450, partial [Neisse... 160 2e-47 gb|KTC66800.1| hypothetical protein Lbir_3102 [Legionella birmin... 158 4e-47 emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria mening... 160 6e-47 gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningi... 160 6e-47 emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria mening... 160 9e-47 emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria mening... 160 9e-47 >gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas titanicae BH1] Length = 163 Score = 216 bits (550), Expect = 2e-69 Identities = 109/150 (72%), Positives = 116/150 (77%) Frame = +3 Query: 3 SACYPRSTFYPLSDGPSIQNHRITLSYFRTCSTCQSRSQARLCLCTNLTISDRN*RTFEL 182 SACYPRSTFYPLSDGPSIQNHRIT + FRTCSTC SRSQA LC CT T+SDR TF L Sbjct: 14 SACYPRSTFYPLSDGPSIQNHRITRTCFRTCSTCLSRSQAPLCSCTQCTMSDRAEGTFVL 73 Query: 183 LRYSLGGDRPSQTAHHTLSPTRITGQG*NPDRTRVVFQGWLH*DWRLSFKASHLSYTDLF 362 LRYSLGGDRPSQT HHTLS RIT N + R+VFQGWL +WR FKAS LSYT Sbjct: 74 LRYSLGGDRPSQTTHHTLSSIRITDLSENANDARLVFQGWLPPNWRPEFKASQLSYTGNI 133 Query: 363 KVQCKATVKVHGVFPSCRG*IASSQRFQFH 452 VQC+A VKVHGVFPS RG ASS+RFQFH Sbjct: 134 SVQCEAIVKVHGVFPSSRGYTASSRRFQFH 163 >dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87487.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO87598.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 201 bits (510), Expect = 3e-62 Identities = 101/136 (74%), Positives = 106/136 (77%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+ TLMPLH DFRP LAYLRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHRSV 361 PPL FGRRPPQSNC P TVP+PD+G RLEP+ +QGGISR AP RLAS SLPPILHRSV Sbjct: 159 PPLRFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSV 218 Query: 362 QSPM*SYSKGSWGLSV 409 QSPM SYSKGSWGLSV Sbjct: 219 QSPMQSYSKGSWGLSV 234 >dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO88159.1| putative membrane protein [Burkholderia sp. RPE67] dbj|BAO90886.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 200 bits (509), Expect = 4e-62 Identities = 101/136 (74%), Positives = 106/136 (77%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+ TLMPLH DFRP LAYLRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHRSV 361 PPL FGRRPPQSNC P TVP+PD+G RLEP+ +QGGISR AP RLAS SLPPILHRSV Sbjct: 159 PPLHFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSV 218 Query: 362 QSPM*SYSKGSWGLSV 409 QSPM SYSKGSWGLSV Sbjct: 219 QSPMQSYSKGSWGLSV 234 >dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 197 bits (500), Expect = 1e-60 Identities = 99/136 (72%), Positives = 105/136 (77%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+ TLMPLH DFRP LAYLRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHRSV 361 PPL FGRRPPQSNC P TVP+PD+G RLEP+ +QGGISR AP +LA SLPPILHRSV Sbjct: 159 PPLPFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPKLAFRFHSLPPILHRSV 218 Query: 362 QSPM*SYSKGSWGLSV 409 QSPM SYSKGSWGLSV Sbjct: 219 QSPMQSYSKGSWGLSV 234 >gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 195 bits (496), Expect = 4e-60 Identities = 98/136 (72%), Positives = 105/136 (77%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+ TLMPLH DFRP LAYL T Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLCT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHRSV 361 PPL FGRRPPQSNC P TVP+PD+G RLEP+ +QGGISR AP RLAS SLPPILH+SV Sbjct: 159 PPLRFGRRPPQSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHKSV 218 Query: 362 QSPM*SYSKGSWGLSV 409 Q+PM SYSKGSWGLSV Sbjct: 219 QNPMQSYSKGSWGLSV 234 >gb|ABM53543.1| conserved hypothetical protein [uncultured beta proteobacterium CBNPD1 BAC clone 578] Length = 114 Score = 168 bits (425), Expect = 6e-51 Identities = 83/114 (72%), Positives = 88/114 (77%) Frame = +1 Query: 43 MALPYRTTGSLCPTFVPARLVSLAVKHAYAFALT*RFXXXXXXXXXXXXXLWEETAPVKL 222 MALPYRTTGSL P+F+PARLVSLAVKHAYA+AL+ RF LWEETAPVKL Sbjct: 1 MALPYRTTGSLSPSFLPARLVSLAVKHAYAYALSARFPTVPSVPSNSSVTLWEETAPVKL 60 Query: 223 PTIHCPQPG*RDKVRTPTGPGWYFKDGSTKTGVLASKPPTYPTQICSKSNVKLQ 384 PTIHCPQPG R KVRT PGWYF GS +T V SKPPTYPTQICSKSNVKLQ Sbjct: 61 PTIHCPQPGSRAKVRTSNTPGWYFNVGSMRTSVRTSKPPTYPTQICSKSNVKLQ 114 >gb|ABJ03470.1| conserved hypothetical protein [Escherichia coli APEC O1] Length = 217 Score = 141 bits (355), Expect(2) = 6e-51 Identities = 80/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (0%) Frame = +2 Query: 158 P*LAYLRTPPLLFGRRPPQSNCPPYTVPNPD-NGTRLEPRQDQGGISRMAPLRLAS*LQS 334 P LA LR PPLLF RRPPQSN PP TV P G LE + +GGISR AP RLAS LQS Sbjct: 66 PGLANLRAPPLLFRRRPPQSNYPPDTVRKPGITGPTLEHQTLKGGISRSAPCRLASTLQS 125 Query: 335 LPPILHRSVQSPM*SYSKGSWGLSVLPRVDCIITAISISLSLWWRQRGHRYAIRA 499 LPPILH Q + SYSKGS GLSVLPRV CI TA SISLSL WRQ GH YAIRA Sbjct: 126 LPPILHIKAQCSVSSYSKGSRGLSVLPRVHCIFTASSISLSLGWRQPGHHYAIRA 180 Score = 87.8 bits (216), Expect(2) = 6e-51 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = +3 Query: 3 SACYPRSTFYPLSDGPSIQNHRITLSYFRTCSTCQSRSQARLCLCTNLTISD 158 SACYPRSTFYPLSDGPSIQNHRIT++ FRTCS +RSQA LC CTNL +S+ Sbjct: 14 SACYPRSTFYPLSDGPSIQNHRITMTCFRTCSRRHARSQAGLCHCTNLLMSE 65 >emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ55632.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP70409.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT55260.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ46117.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ13555.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ36002.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM24872.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM89367.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM29376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM58488.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ43465.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO88989.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM95535.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR30100.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ33640.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ59206.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM36524.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS69311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM22624.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP71542.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM59150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP51019.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM08047.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO07120.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT61805.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM47351.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT94404.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR12276.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN35808.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65428.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS39952.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM58445.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ35548.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR63221.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ50134.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO61260.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP84864.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR81609.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15838.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM62696.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ53410.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ41081.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ35446.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR13064.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93195.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR58618.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN75830.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92984.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN28987.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN69271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM82912.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR53819.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP88866.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM23382.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM26625.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ19861.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT62879.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM53098.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53692.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM83365.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO21529.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN92282.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS58259.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ37187.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS05620.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS03273.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR66185.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ77951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM54395.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR31800.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS23086.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO96526.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS82264.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ60516.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO11803.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO26530.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP00554.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS13977.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ30750.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM62238.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN86557.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN54402.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ65336.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 166 bits (420), Expect = 5e-49 Identities = 82/118 (69%), Positives = 90/118 (76%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+RLEP++ QGGISR AP RLAS LQSLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59615.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS18382.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45378.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ16501.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN87478.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM92680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67326.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP45878.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP38468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ30366.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO45593.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45368.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35122.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ61517.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR11989.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT68492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP89907.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM28216.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ55809.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM90768.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ97896.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS39350.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO06049.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN51672.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM72155.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO27120.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29951.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ78977.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62225.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS89623.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM32710.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 166 bits (420), Expect = 7e-49 Identities = 82/118 (69%), Positives = 90/118 (76%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+RLEP++ QGGISR AP RLAS LQSLPPILH+ Sbjct: 159 PPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILHK 216 >emb|CRY95131.1| hypothetical protein [uncultured prokaryote] Length = 154 Score = 163 bits (412), Expect = 2e-48 Identities = 86/136 (63%), Positives = 94/136 (69%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFH+ PPDH+ TL+PLH DFRP LAYLRT Sbjct: 19 ISLLSPEYLLSVERWPFHSVPPDHYDLLSHLLELWLSQSSTLLPLHYQHDFRPYLAYLRT 78 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHRSV 361 PPL F RRPPQSNC P TVPN + + LEP+ +QGGISR P LA LPPILH+SV Sbjct: 79 PPLPFRRRPPQSNCLPCTVPNSVHLSWLEPQTNQGGISRSTPEELALLFLCLPPILHKSV 138 Query: 362 QSPM*SYSKGSWGLSV 409 S M S SKGSWGLSV Sbjct: 139 HSSMQSCSKGSWGLSV 154 >emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS61864.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 164 bits (416), Expect = 2e-48 Identities = 81/118 (68%), Positives = 89/118 (75%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+RLEP++ QGGISR P RLAS LQSLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTTPQRLASLLQSLPPILHK 202 >emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 163 bits (413), Expect = 5e-48 Identities = 81/118 (68%), Positives = 89/118 (75%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+RLEP++ QGGISR AP RLAS L SLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP44468.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT59196.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS83033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP46906.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP27798.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN98251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04956.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT93866.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP96790.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT92957.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR69071.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN70881.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17584.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ42038.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP73355.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO79925.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR78282.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS37293.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO16958.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 163 bits (413), Expect = 5e-48 Identities = 81/118 (68%), Positives = 89/118 (75%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS LQSLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >emb|CKL43271.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR65376.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO43812.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS31701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR93279.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT88142.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP62169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO09337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS97823.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 163 bits (413), Expect = 8e-48 Identities = 81/118 (68%), Positives = 89/118 (75%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS LQSLPPILH+ Sbjct: 159 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 216 >gb|ELL01666.1| hypothetical protein NM4119_1450, partial [Neisseria meningitidis 4119] Length = 156 Score = 160 bits (406), Expect = 2e-47 Identities = 80/118 (67%), Positives = 88/118 (74%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 39 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 98 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS L SLPPILH+ Sbjct: 99 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 156 >gb|KTC66800.1| hypothetical protein Lbir_3102 [Legionella birminghamensis] gb|KTD49696.1| hypothetical protein Lqui_1907 [Legionella quinlivanii] Length = 107 Score = 158 bits (399), Expect = 4e-47 Identities = 82/106 (77%), Positives = 89/106 (83%) Frame = -2 Query: 323 KTPVLVEPSLKYHPGPVGVLTLSRYPGWGQCMVGSLTGAVSSQRVTEEFEGTLVTVGNRQ 144 +TPV +EP+LKYHP + VLT S +PG GQCMVGSLTGAVSSQRVTEE +GTL TVG+R Sbjct: 2 RTPVRMEPTLKYHPVIIEVLTWSSHPGRGQCMVGSLTGAVSSQRVTEEHKGTLGTVGHRT 61 Query: 143 VSAKA*ACLTARLTSRAGTKVGQSDPVVLYGRAIAQRIKGTPGITG 6 S KA CLTAR T RAGTKVG SDPVVLYGRAIAQRIKGTPGITG Sbjct: 62 KSVKAKGCLTARRTCRAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 107 >emb|CWO51373.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 160 bits (406), Expect = 6e-47 Identities = 80/118 (67%), Positives = 88/118 (74%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS L SLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >gb|EJU56892.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU61973.1| cell wall-associated hydrolase [Neisseria meningitidis NM140] gb|EJU62544.1| cell wall-associated hydrolase [Neisseria meningitidis 69166] gb|ELK74541.1| hypothetical protein NM2006087_0256 [Neisseria meningitidis 2006087] gb|ELL00985.1| hypothetical protein NM12888_1665 [Neisseria meningitidis 12888] emb|CWO33360.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22460.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT52492.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO87056.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP11771.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR97728.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57532.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP67952.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM35585.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN41524.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWU00589.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ40111.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT04099.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP26351.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT63701.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS70177.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO22916.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP54997.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS22406.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR45207.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP03678.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT87473.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP91498.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN67092.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO96602.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO95311.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT55895.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT13818.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48902.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS33681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP78000.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO12897.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS86296.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP20575.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT29169.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP63785.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS84972.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP92574.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP59033.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT49266.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS27719.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM46796.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN46619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ68119.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO15682.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ08477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS17962.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP30862.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO42413.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR29661.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO31337.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ04898.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP10150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM05078.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM12681.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT61744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN57772.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR90150.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT16329.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR30726.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT07011.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP52443.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN21252.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN45814.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN19844.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ43419.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR10684.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR33680.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO48013.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT37813.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP53477.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP86780.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT58035.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN17637.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN08518.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS23659.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR26094.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT34423.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP99181.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36926.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM80848.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN88221.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ99732.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO40610.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO11922.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR49944.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR50940.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ80168.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP28080.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS36757.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN29027.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO57148.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS94689.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWO86275.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34667.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWN65467.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ62273.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWR08251.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT18242.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP36630.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT70851.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ29131.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWM14786.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ17869.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP41619.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT32077.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 160 bits (406), Expect = 6e-47 Identities = 80/118 (67%), Positives = 88/118 (74%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS L SLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 202 >emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWQ03425.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 160 bits (405), Expect = 9e-47 Identities = 80/118 (67%), Positives = 88/118 (74%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 85 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRT 144 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+ + LEP++ QGGISR AP RLAS LQSLPPILH+ Sbjct: 145 PPLRFGRRPPQSNCLPCTVPDPDDESGLEPQRHQGGISRTAPQRLASLLQSLPPILHK 202 >emb|CWO79403.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS73015.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP48004.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT53749.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP56073.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWT45211.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWP40556.1| Cell wall-associated hydrolase [Neisseria meningitidis] emb|CWS34214.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 160 bits (406), Expect = 9e-47 Identities = 80/118 (67%), Positives = 88/118 (74%) Frame = +2 Query: 2 ISLLSPEYLLSVERWPFHTEPPDHFVXXXXXXXXXXXXXXTLMPLH*PDDFRP*LAYLRT 181 ISLLSPEYLLSVERWPFHTEPPDH+V L+PLH DFRP L LRT Sbjct: 99 ISLLSPEYLLSVERWPFHTEPPDHYVLLSHLLDLLVSQLSYLLPLHYQSDFRPDLGNLRT 158 Query: 182 PPLLFGRRPPQSNCPPYTVPNPDNGTRLEPRQDQGGISRMAPLRLAS*LQSLPPILHR 355 PPL FGRRPPQSNC P TVP+PD+G+ LEP++ QGGISR AP RLAS L SLPPILH+ Sbjct: 159 PPLRFGRRPPQSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLLSLPPILHK 216