BLASTX nr result
ID: Ophiopogon22_contig00037020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00037020 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIZ68136.1| ATP binding protein [Ornithogalum saundersiae] 55 8e-06 >gb|AIZ68136.1| ATP binding protein [Ornithogalum saundersiae] Length = 501 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +1 Query: 343 MSFHKSQRELVIAKYLLHVMKEGREVRVRNR 435 ++FHKSQR+L+IA YLLHV+K+G+EVRVRNR Sbjct: 146 LTFHKSQRDLIIADYLLHVLKQGKEVRVRNR 176