BLASTX nr result
ID: Ophiopogon22_contig00036592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00036592 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57251.1| uncharacterized protein A4U43_C10F18150, partial ... 74 6e-14 ref|XP_020247419.1| formin-like protein 2 isoform X3 [Asparagus ... 74 5e-12 ref|XP_020247418.1| small glutamine-rich tetratricopeptide repea... 74 5e-12 ref|XP_020247417.1| small glutamine-rich tetratricopeptide repea... 74 5e-12 >gb|ONK57251.1| uncharacterized protein A4U43_C10F18150, partial [Asparagus officinalis] Length = 90 Score = 73.6 bits (179), Expect = 6e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 26 FSFGEAPQQVSDVLRSVMGMFSAQHGSQQDMHRGGNGA 139 FSFGEAPQ V DVLRSVMGMFS+QHGSQQDMHRG NGA Sbjct: 53 FSFGEAPQHVQDVLRSVMGMFSSQHGSQQDMHRGDNGA 90 >ref|XP_020247419.1| formin-like protein 2 isoform X3 [Asparagus officinalis] Length = 434 Score = 73.6 bits (179), Expect = 5e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 26 FSFGEAPQQVSDVLRSVMGMFSAQHGSQQDMHRGGNGA 139 FSFGEAPQ V DVLRSVMGMFS+QHGSQQDMHRG NGA Sbjct: 397 FSFGEAPQHVQDVLRSVMGMFSSQHGSQQDMHRGDNGA 434 >ref|XP_020247418.1| small glutamine-rich tetratricopeptide repeat-containing protein-like isoform X2 [Asparagus officinalis] Length = 494 Score = 73.6 bits (179), Expect = 5e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 26 FSFGEAPQQVSDVLRSVMGMFSAQHGSQQDMHRGGNGA 139 FSFGEAPQ V DVLRSVMGMFS+QHGSQQDMHRG NGA Sbjct: 457 FSFGEAPQHVQDVLRSVMGMFSSQHGSQQDMHRGDNGA 494 >ref|XP_020247417.1| small glutamine-rich tetratricopeptide repeat-containing protein-like isoform X1 [Asparagus officinalis] Length = 495 Score = 73.6 bits (179), Expect = 5e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 26 FSFGEAPQQVSDVLRSVMGMFSAQHGSQQDMHRGGNGA 139 FSFGEAPQ V DVLRSVMGMFS+QHGSQQDMHRG NGA Sbjct: 458 FSFGEAPQHVQDVLRSVMGMFSSQHGSQQDMHRGDNGA 495