BLASTX nr result
ID: Ophiopogon22_contig00035946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035946 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59297.1| uncharacterized protein A4U43_C08F5000 [Asparagus... 110 4e-26 ref|XP_020242594.1| LOW QUALITY PROTEIN: venom phosphodiesterase... 110 8e-26 gb|KHN32917.1| Ectonucleotide pyrophosphatase/phosphodiesterase ... 98 4e-23 ref|XP_003620941.1| ectonucleotide pyrophosphatase/phosphodieste... 100 2e-22 gb|KHM99847.1| Ectonucleotide pyrophosphatase/phosphodiesterase ... 99 2e-22 gb|AAK84833.1| nucleotide pytophosphatase-like protein, partial ... 92 3e-22 gb|KHN40326.1| Ectonucleotide pyrophosphatase/phosphodiesterase ... 98 4e-22 ref|XP_020098796.1| ectonucleotide pyrophosphatase/phosphodieste... 100 4e-22 gb|OAY79068.1| Venom phosphodiesterase 2 [Ananas comosus] 100 4e-22 gb|KOM54128.1| hypothetical protein LR48_Vigan10g002000 [Vigna a... 100 5e-22 ref|XP_017440179.1| PREDICTED: ectonucleotide pyrophosphatase/ph... 100 5e-22 ref|XP_010942875.1| PREDICTED: venom phosphodiesterase 2-like [E... 100 5e-22 gb|KYP60351.1| Ectonucleotide pyrophosphatase/phosphodiesterase ... 98 7e-22 ref|XP_017240220.1| PREDICTED: venom phosphodiesterase 2-like [D... 99 7e-22 ref|XP_003524421.1| PREDICTED: venom phosphodiesterase 2-like [G... 99 1e-21 gb|KRH41423.1| hypothetical protein GLYMA_08G028900 [Glycine max] 99 1e-21 dbj|GAU11791.1| hypothetical protein TSUD_75420 [Trifolium subte... 99 1e-21 gb|KHN16687.1| Ectonucleotide pyrophosphatase/phosphodiesterase ... 99 1e-21 ref|XP_014633877.1| PREDICTED: uncharacterized protein LOC100793... 99 1e-21 ref|XP_009380444.1| PREDICTED: ectonucleotide pyrophosphatase/ph... 99 2e-21 >gb|ONK59297.1| uncharacterized protein A4U43_C08F5000 [Asparagus officinalis] Length = 387 Score = 110 bits (274), Expect = 4e-26 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLP 202 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNL+TSILGLKGAPN+GS+SFA SVLLP Sbjct: 329 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLMTSILGLKGAPNNGSDSFAESVLLP 385 >ref|XP_020242594.1| LOW QUALITY PROTEIN: venom phosphodiesterase 2-like [Asparagus officinalis] Length = 466 Score = 110 bits (274), Expect = 8e-26 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLP 202 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNL+TSILGLKGAPN+GS+SFA SVLLP Sbjct: 408 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLMTSILGLKGAPNNGSDSFAESVLLP 464 >gb|KHN32917.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 [Glycine soja] Length = 182 Score = 97.8 bits (242), Expect = 4e-23 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGPRF +G+KIPSFENVEIYNL+TSIL +KGAPN+GS SF +SVLLP A Sbjct: 125 FSMRTIFIGHGPRFARGKKIPSFENVEIYNLVTSILDIKGAPNNGSTSFPDSVLLPVA 182 >ref|XP_003620941.1| ectonucleotide pyrophosphatase/phosphodiesterase [Medicago truncatula] gb|AES77159.1| ectonucleotide pyrophosphatase/phosphodiesterase [Medicago truncatula] Length = 471 Score = 100 bits (250), Expect = 2e-22 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGP+FE+G+KIPSFENVEIYNLITSIL +KGAPN+GS+SF SVLLP A Sbjct: 414 FSMRTIFIGHGPQFERGKKIPSFENVEIYNLITSILNIKGAPNNGSDSFPQSVLLPKA 471 >gb|KHM99847.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 [Glycine soja] Length = 312 Score = 99.0 bits (245), Expect = 2e-22 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 +FSMR+IF+GHGPRF +GRKIPSFENVEIYNLITSIL +KGAPN+GS SFA SVLL +A Sbjct: 254 VFSMRTIFIGHGPRFARGRKIPSFENVEIYNLITSILKIKGAPNNGSASFAESVLLSAA 312 >gb|AAK84833.1| nucleotide pytophosphatase-like protein, partial [Elaeis oleifera] Length = 78 Score = 92.4 bits (228), Expect = 3e-22 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+ HGP+FE+GRK+PSFENVEIYN+I SIL LKGAPN+GS SF +++LL SA Sbjct: 21 FSMRTIFISHGPQFERGRKVPSFENVEIYNVIASILKLKGAPNNGSASFPSTILLSSA 78 >gb|KHN40326.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 [Glycine soja] Length = 306 Score = 98.2 bits (243), Expect = 4e-22 Identities = 44/58 (75%), Positives = 54/58 (93%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGPRF +G+KIPSFENV+IYNL+TSIL +KGAPN+GS+SF +SVLLP A Sbjct: 249 FSMRTIFIGHGPRFARGKKIPSFENVQIYNLVTSILDIKGAPNNGSDSFPDSVLLPPA 306 >ref|XP_020098796.1| ectonucleotide pyrophosphatase/phosphodiesterase family member 3-like [Ananas comosus] Length = 475 Score = 100 bits (248), Expect = 4e-22 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 LFSMR+IFV HGP+F++GRKIPSF N+EIYNLITSIL LKGAPN+GS SF NSVLLPSA Sbjct: 417 LFSMRTIFVAHGPQFQRGRKIPSFVNIEIYNLITSILKLKGAPNNGSASFPNSVLLPSA 475 >gb|OAY79068.1| Venom phosphodiesterase 2 [Ananas comosus] Length = 475 Score = 100 bits (248), Expect = 4e-22 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 LFSMR+IFV HGP+F++GRKIPSF N+EIYNLITSIL LKGAPN+GS SF NSVLLPSA Sbjct: 417 LFSMRTIFVAHGPQFQRGRKIPSFVNIEIYNLITSILKLKGAPNNGSASFPNSVLLPSA 475 >gb|KOM54128.1| hypothetical protein LR48_Vigan10g002000 [Vigna angularis] Length = 448 Score = 99.8 bits (247), Expect = 5e-22 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGPRF +GRKIPSFENV+IYNL+TSIL +KGAPNDGS +F +SVLLP+A Sbjct: 391 FSMRTIFIGHGPRFPRGRKIPSFENVQIYNLVTSILDIKGAPNDGSATFPDSVLLPTA 448 >ref|XP_017440179.1| PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 1-like [Vigna angularis] dbj|BAU02996.1| hypothetical protein VIGAN_11259800 [Vigna angularis var. angularis] Length = 449 Score = 99.8 bits (247), Expect = 5e-22 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGPRF +GRKIPSFENV+IYNL+TSIL +KGAPNDGS +F +SVLLP+A Sbjct: 392 FSMRTIFIGHGPRFPRGRKIPSFENVQIYNLVTSILDIKGAPNDGSATFPDSVLLPTA 449 >ref|XP_010942875.1| PREDICTED: venom phosphodiesterase 2-like [Elaeis guineensis] ref|XP_010942940.1| PREDICTED: venom phosphodiesterase 2-like [Elaeis guineensis] Length = 460 Score = 99.8 bits (247), Expect = 5e-22 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPS 199 LFSMR+IF+ HGPRFE+GRKIPSF+NVEIYNL+T+IL L GAPN+GS SF NSVLLPS Sbjct: 402 LFSMRTIFIAHGPRFERGRKIPSFKNVEIYNLVTTILNLNGAPNNGSASFPNSVLLPS 459 >gb|KYP60351.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 [Cajanus cajan] Length = 326 Score = 97.8 bits (242), Expect = 7e-22 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+G GPRF +GRKIPSFENV+IYNL+TSIL ++GAPN+GS SF NSVLLPSA Sbjct: 269 FSMRTIFIGRGPRFARGRKIPSFENVQIYNLVTSILNIQGAPNNGSASFPNSVLLPSA 326 >ref|XP_017240220.1| PREDICTED: venom phosphodiesterase 2-like [Daucus carota subsp. sativus] gb|KZN03225.1| hypothetical protein DCAR_011981 [Daucus carota subsp. sativus] Length = 467 Score = 99.4 bits (246), Expect = 7e-22 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMR+IF+GHGPRF KG K+PSFEN++IYNL+TSILG+KGAPN+G+ SF N VLLP+A Sbjct: 406 FSMRTIFIGHGPRFAKGAKVPSFENIQIYNLVTSILGIKGAPNNGTSSFPNKVLLPAA 463 >ref|XP_003524421.1| PREDICTED: venom phosphodiesterase 2-like [Glycine max] gb|KRH60134.1| hypothetical protein GLYMA_05G222200 [Glycine max] Length = 487 Score = 99.0 bits (245), Expect = 1e-21 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 +FSMR+IF+GHGPRF +GRKIPSFENVEIYNLITSIL +KGAPN+GS SFA SVLL +A Sbjct: 429 VFSMRTIFIGHGPRFARGRKIPSFENVEIYNLITSILKIKGAPNNGSASFAESVLLSAA 487 >gb|KRH41423.1| hypothetical protein GLYMA_08G028900 [Glycine max] Length = 498 Score = 99.0 bits (245), Expect = 1e-21 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 +FSMR+IF+GHGPRF +GRKIPSFENVEIYNLITSIL +KGAPN+GS SFA SVLL +A Sbjct: 440 VFSMRTIFIGHGPRFARGRKIPSFENVEIYNLITSILKIKGAPNNGSASFAESVLLSAA 498 >dbj|GAU11791.1| hypothetical protein TSUD_75420 [Trifolium subterraneum] Length = 499 Score = 99.0 bits (245), Expect = 1e-21 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMRSIF+GHGP+F +GRKIPSFENVEIYNL+TSIL +KGAPN+GS SFA SVLL +A Sbjct: 442 FSMRSIFIGHGPQFARGRKIPSFENVEIYNLVTSILNIKGAPNNGSNSFAESVLLSTA 499 >gb|KHN16687.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 [Glycine soja] Length = 499 Score = 99.0 bits (245), Expect = 1e-21 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 +FSMR+IF+GHGPRF +GRKIPSFENVEIYNLITSIL +KGAPN+GS SFA SVLL +A Sbjct: 441 VFSMRTIFIGHGPRFARGRKIPSFENVEIYNLITSILKIKGAPNNGSASFAESVLLSAA 499 >ref|XP_014633877.1| PREDICTED: uncharacterized protein LOC100793652 [Glycine max] Length = 939 Score = 99.0 bits (245), Expect = 1e-21 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -2 Query: 372 LFSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 +FSMR+IF+GHGPRF +GRKIPSFENVEIYNLITSIL +KGAPN+GS SFA SVLL +A Sbjct: 881 VFSMRTIFIGHGPRFARGRKIPSFENVEIYNLITSILKIKGAPNNGSASFAESVLLSAA 939 >ref|XP_009380444.1| PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 1-like [Musa acuminata subsp. malaccensis] Length = 499 Score = 98.6 bits (244), Expect = 2e-21 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = -2 Query: 369 FSMRSIFVGHGPRFEKGRKIPSFENVEIYNLITSILGLKGAPNDGSESFANSVLLPSA 196 FSMRSIFVGHGPRF++GRK+PSFENVEIYN+I SIL LKGAPNDGS SF +S+LL A Sbjct: 442 FSMRSIFVGHGPRFQRGRKVPSFENVEIYNVIASILNLKGAPNDGSASFPSSILLSHA 499