BLASTX nr result
ID: Ophiopogon22_contig00035943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035943 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244127.1| deSI-like protein At4g17486 [Asparagus offic... 69 2e-11 >ref|XP_020244127.1| deSI-like protein At4g17486 [Asparagus officinalis] gb|ONK59128.1| uncharacterized protein A4U43_C08F3280 [Asparagus officinalis] Length = 219 Score = 69.3 bits (168), Expect = 2e-11 Identities = 42/60 (70%), Positives = 46/60 (76%), Gaps = 5/60 (8%) Frame = -3 Query: 436 PEHLELSDGSESIA-SSMEES---DEDAHQHLL-ASTSETSTAREKSVRLVKDLFTSDTR 272 PEHLELSDGSESIA SSMEES DED QHLL A SE S+AREK V+L +DL TS+ R Sbjct: 160 PEHLELSDGSESIASSSMEESDDDDEDGRQHLLPAPRSEPSSAREKPVKLARDLLTSEVR 219