BLASTX nr result
ID: Ophiopogon22_contig00035931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035931 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67571.1| uncharacterized protein A4U43_C05F1420 [Asparagus... 54 8e-06 >gb|ONK67571.1| uncharacterized protein A4U43_C05F1420 [Asparagus officinalis] Length = 819 Score = 54.3 bits (129), Expect = 8e-06 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -1 Query: 122 VMKRVFGSEAASEVDGSLAPQLKKQRPLLGMAMREVMGVQ 3 +MKRVF E EVDGSLAPQLKKQRP+LG AMR VMGVQ Sbjct: 247 IMKRVFEGE---EVDGSLAPQLKKQRPMLG-AMRGVMGVQ 282