BLASTX nr result
ID: Ophiopogon22_contig00035914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035914 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT81868.1| hypothetical protein VIGAN_03177500 [Vigna angul... 52 3e-06 >dbj|BAT81868.1| hypothetical protein VIGAN_03177500 [Vigna angularis var. angularis] Length = 86 Score = 52.4 bits (124), Expect = 3e-06 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 6/79 (7%) Frame = -2 Query: 310 ILPTTQLPVLHKHAKHIEVYSHFIRDMVLQKKTVTSYASSNNQTDDKGFVSKGLMHLSRY 131 +L PV HK KH+E+Y H IR+ +L K VT + +SN Q ++K L L Sbjct: 10 VLHIASNPVFHKRTKHVEIYYHSIREKLLSKDLVTDFVNSNEQL--ANILTKSLRGLKIN 67 Query: 130 L*LAS------MLQLEGKC 92 L + S MLQLEG+C Sbjct: 68 LYVPSLVHMIYMLQLEGEC 86