BLASTX nr result
ID: Ophiopogon22_contig00035857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035857 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796515.1| PREDICTED: cytochrome P450 86B1-like [Phoeni... 67 2e-10 ref|XP_020263665.1| cytochrome P450 86B1-like [Asparagus officin... 67 2e-10 gb|EPS58816.1| hypothetical protein M569_15996, partial [Genlise... 67 2e-10 ref|XP_006354968.1| PREDICTED: cytochrome P450 86B1-like [Solanu... 61 3e-10 ref|XP_009407623.1| PREDICTED: cytochrome P450 86B1-like isoform... 61 1e-09 gb|OEL18865.1| Cytochrome P450 86B1 [Dichanthelium oligosanthes] 65 1e-09 ref|XP_020085049.1| cytochrome P450 86B1 [Ananas comosus] 64 1e-09 dbj|BAJ87689.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-09 ref|XP_022887122.1| cytochrome P450 86B1-like [Olea europaea var... 60 3e-09 gb|PAN46775.1| hypothetical protein PAHAL_J01435 [Panicum hallii] 64 3e-09 ref|XP_009407697.1| PREDICTED: cytochrome P450 86B1-like isoform... 61 4e-09 ref|XP_002464461.2| cytochrome P450 86B1 [Sorghum bicolor] 64 4e-09 gb|KXG38289.1| hypothetical protein SORBI_3001G213300 [Sorghum b... 64 4e-09 gb|KQK88624.1| hypothetical protein SETIT_034638mg [Setaria ital... 63 5e-09 ref|XP_004982787.1| cytochrome P450 86B1 [Setaria italica] 63 5e-09 ref|NP_001137105.2| uncharacterized protein LOC100217282 [Zea ma... 63 7e-09 ref|XP_010905515.1| PREDICTED: cytochrome P450 86B1-like [Elaeis... 63 7e-09 ref|XP_008797199.1| PREDICTED: cytochrome P450 86B1 [Phoenix dac... 62 1e-08 ref|NP_196442.2| Cytochrome P450 superfamily protein [Arabidopsi... 62 2e-08 ref|XP_021627705.1| cytochrome P450 86B1-like [Manihot esculenta... 62 2e-08 >ref|XP_008796515.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera] Length = 557 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ ALR +MYEW+T VLD MGGTFTFRGPWFT+L Sbjct: 65 GMLPSLLLALRN-DMYEWITGVLDGMGGTFTFRGPWFTNL 103 >ref|XP_020263665.1| cytochrome P450 86B1-like [Asparagus officinalis] Length = 471 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 118 MLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 MLPSL ALR NMYEWLTDVL++ GGTFTFRGPW +SL Sbjct: 1 MLPSLFVALRSNNMYEWLTDVLNNKGGTFTFRGPWCSSL 39 >gb|EPS58816.1| hypothetical protein M569_15996, partial [Genlisea aurea] Length = 498 Score = 67.0 bits (162), Expect = 2e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GM+PSL A+RGGN+Y+WLTDVL GTF FRGPWFT+L Sbjct: 34 GMMPSLFLAVRGGNIYDWLTDVLAERNGTFVFRGPWFTNL 73 >ref|XP_006354968.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum] Length = 540 Score = 60.8 bits (146), Expect(2) = 3e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LR +MYEW++DVL M GTFTFRGPWFT+L Sbjct: 61 GMLPSLILGLRK-DMYEWISDVLCRMNGTFTFRGPWFTNL 99 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -2 Query: 261 TTMASSNQTTLSSSADTLAFGRTFLPEVQTLELFL 157 TT S N T+ SSS + L+ FLPE+Q +E+FL Sbjct: 3 TTFTSINMTSSSSSFEHLSL--FFLPEIQIMEIFL 35 >ref|XP_009407623.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 586 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ +R +MYEW+T VL+ GGTFTFRGPWFT+L Sbjct: 108 GMLPSLLLGIRN-DMYEWVTGVLERQGGTFTFRGPWFTNL 146 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -2 Query: 258 TMASSNQTTLSSSADT---LAFGRTFLPEVQTLELFL 157 TM S N TT+S S ++ + LPE+QT ELFL Sbjct: 46 TMNSCNDTTMSDSQSASPGISGFFSLLPEIQTFELFL 82 >gb|OEL18865.1| Cytochrome P450 86B1 [Dichanthelium oligosanthes] Length = 546 Score = 64.7 bits (156), Expect(2) = 1e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T VL S GGTFTFRGPWFT+L Sbjct: 64 GMLPSLLLGLRG-DMYEWITGVLKSRGGTFTFRGPWFTNL 102 Score = 25.8 bits (55), Expect(2) = 1e-09 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -2 Query: 258 TMASSNQTTLSSSADTLAFGRTFLPEVQTLELFL 157 T A S+ T +++A GR LPEVQTLEL + Sbjct: 6 TAAVSHNATDAAAAGGGGLGR-LLPEVQTLELLV 38 >ref|XP_020085049.1| cytochrome P450 86B1 [Ananas comosus] Length = 568 Score = 64.3 bits (155), Expect(2) = 1e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ ALR +MYEW+T VLD GGTFTFRGPWFT+L Sbjct: 83 GMLPSLLLALRD-DMYEWVTRVLDEQGGTFTFRGPWFTNL 121 Score = 25.8 bits (55), Expect(2) = 1e-09 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 10/44 (22%) Frame = -2 Query: 258 TMASSNQTTLSSS--ADTLAFGRTF--------LPEVQTLELFL 157 TM S+NQT LS A T A + LPE+QT+E+ L Sbjct: 14 TMDSANQTALSDGEGATTAAAASSMASYSLLRLLPEIQTVEILL 57 >dbj|BAJ87689.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 547 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ +RG NMYEW+T VL + GGTFTFRGPWFT+L Sbjct: 68 GMLPSLLLGVRG-NMYEWITGVLKTRGGTFTFRGPWFTNL 106 >ref|XP_022887122.1| cytochrome P450 86B1-like [Olea europaea var. sylvestris] Length = 553 Score = 59.7 bits (143), Expect(2) = 3e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+++VL GTFTFRGPWFT+L Sbjct: 68 GMLPSLIFGLRG-DMYEWVSNVLCRQNGTFTFRGPWFTNL 106 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 261 TTMASSNQTTLSSSADTLAFGRTFLPEVQTLELFL 157 T SS+ + SS D L G +LPE++ +E+FL Sbjct: 8 TNFTSSSSSFSSSFRDFLVRGLIYLPEIKMVEIFL 42 >gb|PAN46775.1| hypothetical protein PAHAL_J01435 [Panicum hallii] Length = 548 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T VL + GGTFTFRGPWFT+L Sbjct: 69 GMLPSLLLGLRG-DMYEWITGVLQARGGTFTFRGPWFTNL 107 >ref|XP_009407697.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 540 Score = 60.8 bits (146), Expect(2) = 4e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ +R +MYEW+T VL+ GGTFTFRGPWFT+L Sbjct: 62 GMLPSLLLGIRN-DMYEWVTGVLERQGGTFTFRGPWFTNL 100 Score = 27.7 bits (60), Expect(2) = 4e-09 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -2 Query: 255 MASSNQTTLSSSADT---LAFGRTFLPEVQTLELFL 157 M S N TT+S S ++ + LPE+QT ELFL Sbjct: 1 MNSCNDTTMSDSQSASPGISGFFSLLPEIQTFELFL 36 >ref|XP_002464461.2| cytochrome P450 86B1 [Sorghum bicolor] Length = 545 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T VL + GGTFTFRGPWFT+L Sbjct: 65 GMLPSLLLGLRG-DMYEWITGVLKARGGTFTFRGPWFTNL 103 >gb|KXG38289.1| hypothetical protein SORBI_3001G213300 [Sorghum bicolor] Length = 548 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T VL + GGTFTFRGPWFT+L Sbjct: 68 GMLPSLLLGLRG-DMYEWITGVLKARGGTFTFRGPWFTNL 106 >gb|KQK88624.1| hypothetical protein SETIT_034638mg [Setaria italica] Length = 641 Score = 63.2 bits (152), Expect(2) = 5e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T +L + GGTFTFRGPWFT+L Sbjct: 166 GMLPSLLLGLRG-DMYEWITGILKARGGTFTFRGPWFTNL 204 Score = 25.0 bits (53), Expect(2) = 5e-09 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 258 TMASSNQTTLSSSADTLAFGRTFLPEVQTLELFL 157 T S N T +++A + LPEVQTLEL + Sbjct: 107 TAVSHNATDAAAAAKLGGGLASLLPEVQTLELLV 140 >ref|XP_004982787.1| cytochrome P450 86B1 [Setaria italica] Length = 541 Score = 63.2 bits (152), Expect(2) = 5e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LRG +MYEW+T +L + GGTFTFRGPWFT+L Sbjct: 66 GMLPSLLLGLRG-DMYEWITGILKARGGTFTFRGPWFTNL 104 Score = 25.0 bits (53), Expect(2) = 5e-09 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 258 TMASSNQTTLSSSADTLAFGRTFLPEVQTLELFL 157 T S N T +++A + LPEVQTLEL + Sbjct: 7 TAVSHNATDAAAAAKLGGGLASLLPEVQTLELLV 40 >ref|NP_001137105.2| uncharacterized protein LOC100217282 [Zea mays] gb|ONM05632.1| Cytochrome P450 86B1 [Zea mays] Length = 540 Score = 62.8 bits (151), Expect = 7e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ +RG +MYEW+T VL + GGTFTFRGPWFT+L Sbjct: 63 GMLPSLLLGIRG-DMYEWITGVLKARGGTFTFRGPWFTNL 101 >ref|XP_010905515.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis] Length = 545 Score = 62.8 bits (151), Expect = 7e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ ALR +MYEW+T VLD MGGTFTF GPW T+L Sbjct: 65 GMLPSLLLALRH-DMYEWITSVLDGMGGTFTFHGPWLTNL 103 >ref|XP_008797199.1| PREDICTED: cytochrome P450 86B1 [Phoenix dactylifera] Length = 546 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+ LR +MYEW+T VLD +GGTF FRGPWFT+L Sbjct: 65 GMLPSLILGLRH-DMYEWITGVLDGLGGTFIFRGPWFTNL 103 >ref|NP_196442.2| Cytochrome P450 superfamily protein [Arabidopsis thaliana] gb|AAM97029.1| cytochrome P450-like protein [Arabidopsis thaliana] gb|AAN15497.1| cytochrome P450-like protein [Arabidopsis thaliana] dbj|BAE99010.1| cytochrome P450 like protein [Arabidopsis thaliana] gb|AED91274.1| Cytochrome P450 superfamily protein [Arabidopsis thaliana] Length = 488 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSL+SA+R N+YEWL+DVL S GTF FRGPWF++L Sbjct: 8 GMLPSLISAVRS-NIYEWLSDVLISQNGTFRFRGPWFSTL 46 >ref|XP_021627705.1| cytochrome P450 86B1-like [Manihot esculenta] gb|OAY37512.1| hypothetical protein MANES_11G107300 [Manihot esculenta] Length = 543 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -1 Query: 121 GMLPSLVSALRGGNMYEWLTDVLDSMGGTFTFRGPWFTSL 2 GMLPSLV L+G NMYEW+TDVL GTF FRGPWF+SL Sbjct: 66 GMLPSLVWGLQG-NMYEWITDVLCQQNGTFRFRGPWFSSL 104