BLASTX nr result
ID: Ophiopogon22_contig00035812
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035812 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65940.1| uncharacterized protein A4U43_C06F2550 [Asparagus... 130 5e-33 ref|XP_020270484.1| beta-glucosidase 25 [Asparagus officinalis] 130 3e-32 gb|OAY70163.1| Beta-glucosidase 25 [Ananas comosus] 105 8e-26 ref|XP_008789190.1| PREDICTED: putative beta-glucosidase 41 isof... 111 1e-25 ref|XP_017979545.1| PREDICTED: putative beta-glucosidase 41 isof... 111 1e-25 ref|XP_017979544.1| PREDICTED: putative beta-glucosidase 41 isof... 111 2e-25 ref|XP_008789189.1| PREDICTED: beta-glucosidase 25 isoform X1 [P... 111 3e-25 ref|XP_017979543.1| PREDICTED: putative beta-glucosidase 41 isof... 111 3e-25 gb|EOY12675.1| Beta glucosidase 41 isoform 1 [Theobroma cacao] 111 3e-25 gb|OAY63560.1| Beta-glucosidase 25 [Ananas comosus] 103 3e-25 ref|XP_016705052.1| PREDICTED: putative beta-glucosidase 41 isof... 110 5e-25 ref|XP_012465335.1| PREDICTED: putative beta-glucosidase 41 isof... 110 5e-25 ref|XP_021287876.1| putative beta-glucosidase 41 isoform X3 [Her... 110 5e-25 ref|XP_020692799.1| putative beta-glucosidase 41 [Dendrobium cat... 110 5e-25 ref|XP_021993182.1| beta-glucosidase 25 [Helianthus annuus] >gi|... 110 6e-25 gb|KJB81859.1| hypothetical protein B456_013G165100 [Gossypium r... 110 6e-25 ref|XP_015897708.1| PREDICTED: putative beta-glucosidase 41 [Ziz... 110 8e-25 ref|XP_006475282.1| PREDICTED: putative beta-glucosidase 41 [Cit... 110 8e-25 ref|XP_021287875.1| putative beta-glucosidase 41 isoform X2 [Her... 110 8e-25 gb|PPR98356.1| hypothetical protein GOBAR_AA22308 [Gossypium bar... 110 8e-25 >gb|ONK65940.1| uncharacterized protein A4U43_C06F2550 [Asparagus officinalis] Length = 380 Score = 130 bits (328), Expect = 5e-33 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 REDRCDVRGYFVWSLLDNWEWN+GYRVRFGLYFVDYK NLTR PKSSV WFK++L++ +Y Sbjct: 309 REDRCDVRGYFVWSLLDNWEWNSGYRVRFGLYFVDYKKNLTRIPKSSVQWFKNILDRDRY 368 Query: 237 ETSYLES 257 +TSYLES Sbjct: 369 KTSYLES 375 >ref|XP_020270484.1| beta-glucosidase 25 [Asparagus officinalis] Length = 515 Score = 130 bits (328), Expect = 3e-32 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 REDRCDVRGYFVWSLLDNWEWN+GYRVRFGLYFVDYK NLTR PKSSV WFK++L++ +Y Sbjct: 444 REDRCDVRGYFVWSLLDNWEWNSGYRVRFGLYFVDYKKNLTRIPKSSVQWFKNILDRDRY 503 Query: 237 ETSYLES 257 +TSYLES Sbjct: 504 KTSYLES 510 >gb|OAY70163.1| Beta-glucosidase 25 [Ananas comosus] Length = 111 Score = 105 bits (261), Expect = 8e-26 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEK 227 +ED C+V GYFVWSLLDNWEWN+GY VRFGLY++DY+NNLTR PK+SV WFK VL+K Sbjct: 52 KEDGCNVGGYFVWSLLDNWEWNSGYTVRFGLYYIDYRNNLTRIPKASVRWFKQVLQK 108 >ref|XP_008789190.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Phoenix dactylifera] Length = 411 Score = 111 bits (278), Expect = 1e-25 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +3 Query: 45 SNICREDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLE 224 S + RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDY+NNLTR PK+S WF+H L+ Sbjct: 350 SAVIREDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKASAKWFRHFLQ 409 Query: 225 K 227 + Sbjct: 410 R 410 >ref|XP_017979545.1| PREDICTED: putative beta-glucosidase 41 isoform X3 [Theobroma cacao] Length = 420 Score = 111 bits (278), Expect = 1e-25 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK VL Sbjct: 354 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRVPKASVEWFKGVL 408 >ref|XP_017979544.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Theobroma cacao] Length = 482 Score = 111 bits (278), Expect = 2e-25 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK VL Sbjct: 416 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRVPKASVEWFKGVL 470 >ref|XP_008789189.1| PREDICTED: beta-glucosidase 25 isoform X1 [Phoenix dactylifera] Length = 497 Score = 111 bits (278), Expect = 3e-25 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = +3 Query: 45 SNICREDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLE 224 S + RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDY+NNLTR PK+S WF+H L+ Sbjct: 436 SAVIREDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKASAKWFRHFLQ 495 Query: 225 K 227 + Sbjct: 496 R 496 >ref|XP_017979543.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Theobroma cacao] Length = 509 Score = 111 bits (278), Expect = 3e-25 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK VL Sbjct: 443 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRVPKASVEWFKGVL 497 >gb|EOY12675.1| Beta glucosidase 41 isoform 1 [Theobroma cacao] Length = 509 Score = 111 bits (278), Expect = 3e-25 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK VL Sbjct: 443 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRVPKASVEWFKGVL 497 >gb|OAY63560.1| Beta-glucosidase 25 [Ananas comosus] Length = 111 Score = 103 bits (257), Expect = 3e-25 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEK 227 +ED C+V GYFVWSLLDNWEWN+GY VRFGLY++DY+NNLTR PK+S WFK VL+K Sbjct: 52 KEDGCNVGGYFVWSLLDNWEWNSGYTVRFGLYYIDYRNNLTRIPKASARWFKQVLQK 108 >ref|XP_016705052.1| PREDICTED: putative beta-glucosidase 41 isoform X4 [Gossypium hirsutum] Length = 417 Score = 110 bits (274), Expect = 5e-25 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED+CDVRGYFVWSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WFK L + + Sbjct: 354 REDKCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVEWFKSFLRPRTH 413 >ref|XP_012465335.1| PREDICTED: putative beta-glucosidase 41 isoform X3 [Gossypium raimondii] Length = 417 Score = 110 bits (274), Expect = 5e-25 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED+CDVRGYFVWSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WFK L + + Sbjct: 354 REDKCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSFLRPRTH 413 >ref|XP_021287876.1| putative beta-glucosidase 41 isoform X3 [Herrania umbratica] Length = 420 Score = 110 bits (274), Expect = 5e-25 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK +L Sbjct: 354 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRIPKASVEWFKGLL 408 >ref|XP_020692799.1| putative beta-glucosidase 41 [Dendrobium catenatum] Length = 498 Score = 110 bits (276), Expect = 5e-25 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKK 230 RED CDVRGYFVWSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WF+ L KK Sbjct: 441 REDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFRDALSKK 498 >ref|XP_021993182.1| beta-glucosidase 25 [Helianthus annuus] gb|OTG07587.1| putative beta glucosidase 41 [Helianthus annuus] Length = 526 Score = 110 bits (276), Expect = 6e-25 Identities = 49/60 (81%), Positives = 51/60 (85%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED CDVRGYFVWSLLDNWEWN GY VRFGLY+VDYKNNLTR PKSSV WFK VL+ Y Sbjct: 461 REDGCDVRGYFVWSLLDNWEWNYGYTVRFGLYYVDYKNNLTRIPKSSVNWFKGVLKSDGY 520 >gb|KJB81859.1| hypothetical protein B456_013G165100 [Gossypium raimondii] gb|KJB81860.1| hypothetical protein B456_013G165100 [Gossypium raimondii] Length = 439 Score = 110 bits (274), Expect = 6e-25 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED+CDVRGYFVWSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WFK L + + Sbjct: 376 REDKCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSFLRPRTH 435 >ref|XP_015897708.1| PREDICTED: putative beta-glucosidase 41 [Ziziphus jujuba] Length = 505 Score = 110 bits (275), Expect = 8e-25 Identities = 48/64 (75%), Positives = 52/64 (81%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED CDVRGYFVWSLLDNWEWN GY VRFGLY+VDYKNNLTR PK+SV WFK +L Sbjct: 440 REDECDVRGYFVWSLLDNWEWNLGYTVRFGLYYVDYKNNLTRIPKTSVQWFKGILRPGFQ 499 Query: 237 ETSY 248 + SY Sbjct: 500 KLSY 503 >ref|XP_006475282.1| PREDICTED: putative beta-glucosidase 41 [Citrus sinensis] ref|XP_024047989.1| putative beta-glucosidase 41 isoform X1 [Citrus clementina] Length = 506 Score = 110 bits (275), Expect = 8e-25 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKK 230 RED CDVRGYF+WSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WFK +L K Sbjct: 441 REDNCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVEWFKRMLRLK 498 >ref|XP_021287875.1| putative beta-glucosidase 41 isoform X2 [Herrania umbratica] Length = 464 Score = 110 bits (274), Expect = 8e-25 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVL 221 RED CDVRGYFVWSLLDNWEWN+GY VRFGLYFVDYKNNLTR PK+SV WFK +L Sbjct: 398 REDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRIPKASVEWFKGLL 452 >gb|PPR98356.1| hypothetical protein GOBAR_AA22308 [Gossypium barbadense] Length = 471 Score = 110 bits (274), Expect = 8e-25 Identities = 46/60 (76%), Positives = 52/60 (86%) Frame = +3 Query: 57 REDRCDVRGYFVWSLLDNWEWNTGYRVRFGLYFVDYKNNLTRTPKSSVPWFKHVLEKKQY 236 RED+CDVRGYFVWSLLDNWEWN+GY VRFGLY+VDYKNNLTR PK+SV WFK L + + Sbjct: 408 REDKCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSFLRPRTH 467