BLASTX nr result
ID: Ophiopogon22_contig00035786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035786 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021982970.1| DNA-3-methyladenine glycosylase 1-like [Heli... 57 7e-07 ref|XP_021982968.1| probable DNA-3-methyladenine glycosylase 2 i... 55 5e-06 dbj|GAV81684.1| HhH-GPD domain-containing protein [Cephalotus fo... 54 7e-06 >ref|XP_021982970.1| DNA-3-methyladenine glycosylase 1-like [Helianthus annuus] gb|OTG15546.1| putative DNA glycosylase, Helix-turn-helix, base-excision DNA repair [Helianthus annuus] Length = 313 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = -1 Query: 329 NRRPLNLHPICLLPRPLTSSGEFSAVLSHLRSVDPILSSVIDHHPPSSFQSS 174 +R PLN+ + +PL++ GE SA ++HLRS DP+L+ VID+HPP SF S+ Sbjct: 87 SRSPLNIPKV---NKPLSTPGEISAAINHLRSADPLLADVIDNHPPPSFDSN 135 >ref|XP_021982968.1| probable DNA-3-methyladenine glycosylase 2 isoform X1 [Helianthus annuus] ref|XP_021982969.1| probable DNA-3-methyladenine glycosylase 2 isoform X2 [Helianthus annuus] gb|OTG15542.1| putative DNA glycosylase, Helix-turn-helix, base-excision DNA repair [Helianthus annuus] Length = 380 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -1 Query: 287 RPLTSSGEFSAVLSHLRSVDPILSSVIDHHPPSSFQSSLIP 165 +PL++ GE SA ++HLRS DP+L+ VID+HPP SF S+ P Sbjct: 114 KPLSAPGEISAAINHLRSTDPLLADVIDNHPPPSFDSNQPP 154 >dbj|GAV81684.1| HhH-GPD domain-containing protein [Cephalotus follicularis] Length = 353 Score = 54.3 bits (129), Expect = 7e-06 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = -1 Query: 332 TNRRPLNLHPICLLPRPLTSSGEFSAVLSHLRSVDPILSSVIDHHPPSSFQSSLIP 165 T R L +H I + RPLT GE A + HLR+ DP+L+S+ID HPP SF++ P Sbjct: 82 TQHRALVVHRI--VSRPLTCDGEVDAAIRHLRNADPLLASLIDVHPPPSFETFQTP 135