BLASTX nr result
ID: Ophiopogon22_contig00035427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035427 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252514.1| probable GTP-binding protein OBGM, mitochond... 61 2e-07 >ref|XP_020252514.1| probable GTP-binding protein OBGM, mitochondrial [Asparagus officinalis] ref|XP_020252515.1| probable GTP-binding protein OBGM, mitochondrial [Asparagus officinalis] gb|ONK76922.1| uncharacterized protein A4U43_C02F1280 [Asparagus officinalis] Length = 624 Score = 61.2 bits (147), Expect = 2e-07 Identities = 38/91 (41%), Positives = 48/91 (52%) Frame = -3 Query: 611 KSLQPWEIPDTDQVGSSKSLQHSENRVSSVNSLDKEATDDSPSPQPKGYVEKSDGLHRKV 432 KSLQPWEIP+TD+ G S+S Q S + V LD KGY S G HRK Sbjct: 154 KSLQPWEIPETDEAGKSRSFQPSNSSV-----LD------------KGYGRNSGGSHRKA 196 Query: 431 SETPGSTGAKGKANFRHPSSRHESDDKMIKV 339 ETP + KA+ + S ESD +M++V Sbjct: 197 FETP-----REKADLKRSHSHFESDSRMLRV 222