BLASTX nr result
ID: Ophiopogon22_contig00035417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035417 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76793.1| uncharacterized protein A4U43_C03F32200 [Asparagu... 72 8e-12 gb|ONK80596.1| uncharacterized protein A4U43_C01F19590 [Asparagu... 58 4e-08 >gb|ONK76793.1| uncharacterized protein A4U43_C03F32200 [Asparagus officinalis] Length = 351 Score = 71.6 bits (174), Expect = 8e-12 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +2 Query: 92 ASDTTGYRHRPTVDLREHLTHKRNIHNVAPRCHCERLANVILDGCQCGGSSKPSGFETL 268 +S+ G PT DLRE+LT KR IH P+CHCERL + +L CQC G++KPS FE L Sbjct: 288 SSEAGGCHQPPTEDLREYLTRKRTIHKANPQCHCERLIHTVLADCQCIGTAKPSVFERL 346 >gb|ONK80596.1| uncharacterized protein A4U43_C01F19590 [Asparagus officinalis] Length = 409 Score = 58.2 bits (139), Expect(2) = 4e-08 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +2 Query: 131 DLREHLTHKRNIHNVAPRCHCERLANVILDGCQCGGSSKPSGFETL 268 DLRE+LT KR I P+C CERL + +L CQC G++KPS FE L Sbjct: 207 DLREYLTPKRTISEANPQCQCERLIHTVLADCQCVGTAKPSVFERL 252 Score = 26.9 bits (58), Expect(2) = 4e-08 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 261 RLSERPVEMKFPRRTCNRVRRQAPEDLDLPVATVNMIGKSK 383 RLS++ + RR + +DL+L TVNM K K Sbjct: 251 RLSQQSSRPRLSRRRRRHQKGSVADDLELASVTVNMTDKEK 291