BLASTX nr result
ID: Ophiopogon22_contig00035371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035371 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241090.1| uncharacterized protein LOC109819684 [Aspara... 70 3e-11 >ref|XP_020241090.1| uncharacterized protein LOC109819684 [Asparagus officinalis] gb|ONK60244.1| uncharacterized protein A4U43_C08F15930 [Asparagus officinalis] Length = 735 Score = 70.1 bits (170), Expect = 3e-11 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -3 Query: 407 ESVRYRPERVASLPSEPTSPVVEAGASKGPDRATSMQPHLLNPGGARLHQRL 252 ES+RYRPERVASLP E T+PVVE G + P R TS+QP ++P G RLH RL Sbjct: 668 ESLRYRPERVASLPPELTTPVVEGGVGRRPVRTTSLQPDSMSPNGGRLHPRL 719