BLASTX nr result
ID: Ophiopogon22_contig00035354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035354 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924512.1| PREDICTED: probable protein phosphatase 2C 6... 55 5e-06 >ref|XP_010924512.1| PREDICTED: probable protein phosphatase 2C 67 [Elaeis guineensis] ref|XP_010924520.1| PREDICTED: probable protein phosphatase 2C 67 [Elaeis guineensis] ref|XP_010924529.1| PREDICTED: probable protein phosphatase 2C 67 [Elaeis guineensis] Length = 381 Score = 55.5 bits (132), Expect = 5e-06 Identities = 35/80 (43%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = -2 Query: 239 MADSKREANLQDEVLTSKKSKVTDLDAESKESERKCFDTHDLEAKEAVFTKSDIRNGSNS 60 MAD KREA+ QDE +K++K TDLDAE E R + LE+ V ++ NGSNS Sbjct: 1 MADHKREADSQDECFIAKRTKATDLDAEGGEKGRVEKENDVLESNLQVSNETISPNGSNS 60 Query: 59 QQGISNKGMKNSP-PEMSSS 3 QQ +S K + PE++S+ Sbjct: 61 QQELSKDCKKVAEIPEINSA 80