BLASTX nr result
ID: Ophiopogon22_contig00035347
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00035347 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535115.1| PREDICTED: heat shock protein 90-5, chloropl... 54 6e-06 >ref|XP_002535115.1| PREDICTED: heat shock protein 90-5, chloroplastic, partial [Ricinus communis] gb|EEF27267.1| heat shock protein, putative, partial [Ricinus communis] Length = 220 Score = 53.5 bits (127), Expect = 6e-06 Identities = 27/47 (57%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +3 Query: 225 VDILLYDVKFHC-LFVNICFGNSSDALEKLRFLSVTEPSLLGDAGDL 362 +D++++ + H +F+ N+SDAL+KLRFLSVTEPSLLGDAGDL Sbjct: 99 LDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLGDAGDL 145